SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156502012|ref|YP_001428077.1| from Francisella tularensis subsp. holarctica FTNF002-00

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156502012|ref|YP_001428077.1|
Domain Number 1 Region: 89-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-65
Family RecA protein-like (ATPase-domain) 0.0000000118
Further Details:      
 
Domain Number 2 Region: 47-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.6e-25
Family Cold shock DNA-binding domain-like 0.0000579
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000157
Family Rho termination factor, N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156502012|ref|YP_001428077.1|
Sequence length 420
Comment transcription termination factor Rho [Francisella tularensis subsp. holarctica FTNF002-00]
Sequence
MNLNELKYKSVNELMDIAQSLDLESLRARKQELIFSILKYHADKGEDIYGEGILEVLQDG
YGFLRSSDSSYFASPDDIYVSPAFIRKLNLRTGDSIVGKIRPPRENEKYFAVKHIDSVNF
DSPELARKKILFENLTPEYAKERLTMEIGNGSNEDITARVIDLAAPFGKGQRGLIVAPPK
TGKTIMMQNIATSIAKNHPECNLIMLLIDERPEEVTEMQRSVRGEVVASTFDEPAARHVQ
LAEIVIEKAKRLVEHKQDVVILLDSITRLARAYNTVSPASGRVLSGGVEANALQKPKRFF
GAARNTAEGGSLTIIATALVETGSKMDEVIFEEFKGTGNMELHLDRKIAERRVFPAISFD
RSGTRREELLTTPEELQKLWVLRKILGGMEDVQAMEFLTEKMKGSLTNEEFFETMKRGAI
Download sequence
Identical sequences A0A0B3WKA9 A0A0E2ZPG8 A0A0G2RQ31 A0A153JBR8 A0A1I9YBA3 A0A1J0KQB3 A0Q7S0 F4BH33 Q5NF08
WP_003015002.1.100020 WP_003015002.1.100480 WP_003015002.1.100639 WP_003015002.1.101979 WP_003015002.1.10388 WP_003015002.1.11004 WP_003015002.1.11577 WP_003015002.1.11695 WP_003015002.1.12700 WP_003015002.1.12820 WP_003015002.1.13116 WP_003015002.1.1316 WP_003015002.1.13715 WP_003015002.1.13896 WP_003015002.1.1431 WP_003015002.1.15828 WP_003015002.1.17117 WP_003015002.1.18135 WP_003015002.1.1833 WP_003015002.1.19035 WP_003015002.1.19348 WP_003015002.1.21553 WP_003015002.1.21561 WP_003015002.1.2186 WP_003015002.1.2301 WP_003015002.1.24109 WP_003015002.1.24307 WP_003015002.1.2436 WP_003015002.1.25474 WP_003015002.1.25812 WP_003015002.1.26434 WP_003015002.1.27183 WP_003015002.1.27408 WP_003015002.1.28031 WP_003015002.1.28288 WP_003015002.1.30377 WP_003015002.1.31247 WP_003015002.1.3134 WP_003015002.1.31410 WP_003015002.1.31907 WP_003015002.1.33374 WP_003015002.1.34036 WP_003015002.1.35898 WP_003015002.1.35965 WP_003015002.1.36081 WP_003015002.1.36481 WP_003015002.1.36632 WP_003015002.1.37362 WP_003015002.1.37819 WP_003015002.1.38195 WP_003015002.1.3831 WP_003015002.1.38368 WP_003015002.1.38474 WP_003015002.1.38662 WP_003015002.1.38763 WP_003015002.1.3975 WP_003015002.1.40634 WP_003015002.1.40692 WP_003015002.1.41167 WP_003015002.1.43575 WP_003015002.1.43725 WP_003015002.1.43882 WP_003015002.1.44313 WP_003015002.1.44744 WP_003015002.1.44922 WP_003015002.1.45210 WP_003015002.1.45908 WP_003015002.1.4633 WP_003015002.1.46791 WP_003015002.1.46956 WP_003015002.1.47340 WP_003015002.1.48020 WP_003015002.1.48098 WP_003015002.1.48962 WP_003015002.1.50994 WP_003015002.1.51529 WP_003015002.1.52816 WP_003015002.1.5414 WP_003015002.1.54420 WP_003015002.1.5487 WP_003015002.1.54961 WP_003015002.1.55289 WP_003015002.1.56738 WP_003015002.1.57478 WP_003015002.1.5829 WP_003015002.1.59625 WP_003015002.1.59804 WP_003015002.1.59871 WP_003015002.1.5992 WP_003015002.1.60112 WP_003015002.1.60146 WP_003015002.1.60504 WP_003015002.1.61154 WP_003015002.1.63091 WP_003015002.1.63562 WP_003015002.1.64199 WP_003015002.1.64987 WP_003015002.1.65566 WP_003015002.1.65967 WP_003015002.1.66025 WP_003015002.1.66077 WP_003015002.1.66092 WP_003015002.1.67317 WP_003015002.1.6752 WP_003015002.1.68327 WP_003015002.1.69118 WP_003015002.1.69545 WP_003015002.1.69933 WP_003015002.1.70888 WP_003015002.1.7106 WP_003015002.1.72408 WP_003015002.1.72665 WP_003015002.1.72761 WP_003015002.1.73228 WP_003015002.1.73973 WP_003015002.1.74506 WP_003015002.1.74697 WP_003015002.1.75261 WP_003015002.1.76402 WP_003015002.1.77053 WP_003015002.1.77714 WP_003015002.1.77892 WP_003015002.1.78176 WP_003015002.1.78521 WP_003015002.1.80474 WP_003015002.1.80603 WP_003015002.1.80616 WP_003015002.1.82216 WP_003015002.1.82488 WP_003015002.1.8254 WP_003015002.1.82545 WP_003015002.1.83968 WP_003015002.1.84288 WP_003015002.1.84370 WP_003015002.1.85044 WP_003015002.1.85695 WP_003015002.1.85899 WP_003015002.1.87224 WP_003015002.1.87451 WP_003015002.1.87851 WP_003015002.1.88243 WP_003015002.1.89268 WP_003015002.1.89309 WP_003015002.1.90324 WP_003015002.1.91892 WP_003015002.1.92567 WP_003015002.1.93025 WP_003015002.1.93182 WP_003015002.1.95205 WP_003015002.1.95453 WP_003015002.1.95669 WP_003015002.1.9679 WP_003015002.1.96937 WP_003015002.1.97486 WP_003015002.1.98147 WP_003015002.1.99661 YP_170384.1.84429 gi|56708488|ref|YP_170384.1| gi|156502012|ref|YP_001428077.1| gi|422938451|ref|YP_007011598.1| gi|387825057|ref|YP_005824528.1| gi|115314486|ref|YP_763209.1| gi|385795159|ref|YP_005831565.1| gi|385793382|ref|YP_005826358.1| gi|110670959|ref|YP_667516.1| gi|379726322|ref|YP_005318508.1| 119857.FTL_0610 177416.FTT_1446 393011.FTH_0611 393115.FTF1446 401614.FTN_1416 458234.FTA_0645 gi|89256008|ref|YP_513370.1| gi|118497989|ref|YP_899039.1| gi|379717718|ref|YP_005306054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]