SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384430931|ref|YP_005640291.1| from Thermus thermophilus SG0.5JP17-16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384430931|ref|YP_005640291.1|
Domain Number 1 Region: 219-359
Classification Level Classification E-value
Superfamily CBS-domain pair 1.52e-36
Family CBS-domain pair 0.0024
Further Details:      
 
Domain Number 2 Region: 360-441
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.91e-25
Family CorC/HlyC domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384430931|ref|YP_005640291.1|
Sequence length 444
Comment hypothetical protein [Thermus thermophilus SG0.5JP17-16]
Sequence
MDRPPSRWLLLWILGSPALAQGEAASPENPWLWAVLVLLFALSAFFSASETAITTLYPWK
LRELAESKNGPFRLLAEDITRFLTTILVGNNLVNIAATALVTELATQAFGSAGVGVATGA
MTFLILFFGEITPKSLAVHHAEAIARLAAWPIYGLSVLFYPIGRFFSLVSGGLLRLLGLE
PRGTPLVSEEELKLILAGAEESGAIEAQEEEMIHSILELEETPVREIMTPRVEMVAIEAD
ATLEDFLHLFREHRYSRVPVYRESVDHIVGVAYAQDLLTYYCEEDLKAFKVVSIAHPPYF
VPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEIVGEIYDETDEPEDAAI
RRLPDGSLSIQAQTPIDEVSEALGVELPEGEYDTLSGFLYALFGRIPSVGESVEWQGFRF
VVESADQRRIERVRVERLVEHGEG
Download sequence
Identical sequences F6DFS8
WP_014510130.1.96068 gi|384430931|ref|YP_005640291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]