SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188581401|ref|YP_001924846.1| from Methylobacterium populi BJ001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188581401|ref|YP_001924846.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.01e-36
Family Ribosomal protein L6 0.0000302
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.96e-22
Family Ribosomal protein L6 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188581401|ref|YP_001924846.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Methylobacterium populi BJ001]
Sequence
MSRVGKKPVPVPSGVTATVTGQTVKMKGSKGELQFVVPPQVIVEFKDGAVSVQPKDQSKQ
ARSLWGTSRAQVANLVEGVSKGFEKKLEITGVGYRAAMAGKALKLSLGYSHDIEYEIPAG
ITIVTPKPTEIVVSGIDRQRVGQVAAEIREYRGPEPYKGKGVKYAGEFIFRKEGKKK
Download sequence
Identical sequences A0A177IT63 B1Z778
gi|188581401|ref|YP_001924846.1| 441620.Mpop_2149 WP_012454046.1.71917 WP_012454046.1.72001 WP_012454046.1.78039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]