SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188582643|ref|YP_001926088.1| from Methylobacterium populi BJ001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188582643|ref|YP_001926088.1|
Domain Number 1 Region: 74-138,183-260
Classification Level Classification E-value
Superfamily CBS-domain pair 1.24e-32
Family CBS-domain pair 0.0064
Further Details:      
 
Domain Number 2 Region: 270-351
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000134
Family CorC/HlyC domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188582643|ref|YP_001926088.1|
Sequence length 384
Comment hypothetical protein Mpop_3402 [Methylobacterium populi BJ001]
Sequence
MTNDRSRGAALAAPAADAEPPPREAWYDRLLNVFNLRPRDSLRTDIEEALAEPDTGEDAF
SPLERAMLKNVLGLHKVRVDDVMLPRADIVAVASDTSLGDLLRLFRTAGHSRLPVYGETL
DDPRGMVHIRDFVEYLATQAEAAPRRPAPRVVNDGEADGESKPAPRPRRTASARGALRSL
DLGKVDLTATLASTRIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYGGTDGLISIE
DLIEMVVGDIEDEHDVAEGRLVNRMEGEAEAYIADARAGLAEVSEATGLDLAAAFGEVAE
EIDTIGGLVVTLAGRVPERGERIAGPEDIEFEVLDADPRRVKRIKLQRAPAKIGTVVPLA
LPPPRAVPHSSAEPDTAQAAEAGR
Download sequence
Identical sequences A0A177J1Z6 B1ZJR8
gi|188582643|ref|YP_001926088.1| WP_012455270.1.72001 WP_012455270.1.78039 441620.Mpop_3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]