SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86741215|ref|YP_481615.1| from Frankia sp. CcI3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86741215|ref|YP_481615.1|
Domain Number 1 Region: 194-340
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.17e-35
Family Aromatic dioxygenase reductase-like 0.002
Further Details:      
 
Domain Number 2 Region: 102-201
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.33e-25
Family Ferredoxin reductase FAD-binding domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 4-96
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.18e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86741215|ref|YP_481615.1|
Sequence length 350
Comment oxidoreductase FAD-binding region [Frankia sp. CcI3]
Sequence
MSDTHRVRFEPVDVEIEVTEDETVLDAAFRQGVNLMHGCKEGQCSACKSFLLDGDVQMGR
YSTFALADYESDEGYILLCRAHAFSDLSVELVNYDEDMIRSGLPVRTIESTVVETEDLTH
DITRLRLDITGSPDFMFHPGQYVDITIPGSSEHRSFSMANISAAEGYLEFIIKKYPGGRF
SGLLEDGLRPDDPLTVTGPYGAFTLRVSSDRRIVFIGGGAGMAPILSLLRQLATKNSERE
VVFYYGARAPRDLFYVDEILQTGASIPGFTFVPCLSDSMPENSDDIGHPVENGLVTDIVD
RRETDIASCDVYLCGPPPMIDAALPRLESSGVPKEQIFYDKFTITAAAES
Download sequence
Identical sequences A0A062WZW3 A0A1X1PXA2 Q2JA06
106370.Francci3_2519 gi|86741215|ref|YP_481615.1| WP_011436929.1.5445 WP_011436929.1.57996 WP_011436929.1.64980 WP_011436929.1.93808 WP_011436929.1.9943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]