SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|60682232|ref|YP_212376.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|60682232|ref|YP_212376.1|
Domain Number - Region: 37-48
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0837
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|60682232|ref|YP_212376.1|
Sequence length 99
Comment hypothetical protein BF2760 [Bacteroides fragilis NCTC 9343]
Sequence
MLCQNSPQSSTEQSITEQSITEFFTTNQQLKIVSVLLCVLCGEYGHTSESPAEKVFGSLI
IAKEIEKRVPAINQSVLFLFILVDNNGEKVVKIYTLTNK
Download sequence
Identical sequences A0A139TB79 A0A149NEQ2 Q5LBR3
272559.BF2760 gi|60682232|ref|YP_212376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]