SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|60683454|ref|YP_213598.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60683454|ref|YP_213598.1|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-24
Family Ribosomal protein L11, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|60683454|ref|YP_213598.1|
Sequence length 147
Comment 50S ribosomal protein L11 [Bacteroides fragilis NCTC 9343]
Sequence
MAKEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITY
YADKSFDFVIKTPPVAIQLLEVAKVKSGSAEPNRKKVAEITWEQVRTIAQDKMVDLNCFT
VEAAMRMVAGTARSMGIAVKGEFPVNN
Download sequence
Identical sequences A0A0E2A6W0 A0A0E2AVU4 A0A0K6BZU5 A0A139T0D0 D1JVV0 E1WPE8 I9B126 K1G466 Q5L893 Q64NJ3
272559.BF4019 295405.BF4196 gi|53715481|ref|YP_101473.1| gi|375360257|ref|YP_005113029.1| WP_005791514.1.10040 WP_005791514.1.100686 WP_005791514.1.10083 WP_005791514.1.101046 WP_005791514.1.10405 WP_005791514.1.11335 WP_005791514.1.15557 WP_005791514.1.18542 WP_005791514.1.2011 WP_005791514.1.21107 WP_005791514.1.21713 WP_005791514.1.21908 WP_005791514.1.22050 WP_005791514.1.23698 WP_005791514.1.26260 WP_005791514.1.26832 WP_005791514.1.26934 WP_005791514.1.30158 WP_005791514.1.30608 WP_005791514.1.31541 WP_005791514.1.32651 WP_005791514.1.33107 WP_005791514.1.34692 WP_005791514.1.35533 WP_005791514.1.35582 WP_005791514.1.35818 WP_005791514.1.36984 WP_005791514.1.37052 WP_005791514.1.37988 WP_005791514.1.38746 WP_005791514.1.39779 WP_005791514.1.40326 WP_005791514.1.4066 WP_005791514.1.42362 WP_005791514.1.43770 WP_005791514.1.43857 WP_005791514.1.44936 WP_005791514.1.456 WP_005791514.1.46679 WP_005791514.1.48703 WP_005791514.1.49420 WP_005791514.1.49748 WP_005791514.1.50677 WP_005791514.1.50935 WP_005791514.1.51373 WP_005791514.1.5142 WP_005791514.1.51489 WP_005791514.1.52936 WP_005791514.1.53885 WP_005791514.1.53910 WP_005791514.1.53995 WP_005791514.1.54019 WP_005791514.1.55270 WP_005791514.1.56204 WP_005791514.1.57121 WP_005791514.1.58084 WP_005791514.1.60699 WP_005791514.1.60854 WP_005791514.1.6251 WP_005791514.1.63108 WP_005791514.1.63590 WP_005791514.1.63925 WP_005791514.1.65409 WP_005791514.1.65726 WP_005791514.1.65921 WP_005791514.1.66858 WP_005791514.1.66941 WP_005791514.1.69826 WP_005791514.1.73957 WP_005791514.1.75668 WP_005791514.1.7580 WP_005791514.1.76253 WP_005791514.1.78347 WP_005791514.1.81678 WP_005791514.1.85293 WP_005791514.1.87523 WP_005791514.1.88754 WP_005791514.1.89499 WP_005791514.1.89819 WP_005791514.1.91045 WP_005791514.1.91849 WP_005791514.1.93484 WP_005791514.1.9461 WP_005791514.1.94953 WP_005791514.1.95091 WP_005791514.1.95195 WP_005791514.1.95750 WP_005791514.1.97349 WP_005791514.1.97964 YP_101473.1.45732 gi|60683454|ref|YP_213598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]