SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Afum_A1163:AFUB_010540.t1 from Aspergillus fumigatus A1163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afum_A1163:AFUB_010540.t1
Domain Number 1 Region: 343-405,484-583,657-723
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-19
Family Voltage-gated potassium channels 0.01
Further Details:      
 
Domain Number 2 Region: 756-990
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-18
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 3 Region: 1188-1357,1395-1472
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000863
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 1769-1839
Classification Level Classification E-value
Superfamily EF-hand 0.000000893
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 5 Region: 1523-1765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000157
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Afum_A1163:AFUB_010540.t1
Sequence length 2125
Comment gene=AFUB_010540 DS499594:complement(join(2991132..2992079,2992130..2992893,2992949..2993612,2993672..2996038,2996089..2997723))
Sequence
MASNSHNRGHNEDNAPTDQSIPLQDLSGPLERNPSRTSRVGNRFLSRRSLRRGGSLSNYE
KVSEESPVEPPPVARRARPQQAGHGNEDEFHIEDPGTFAQAMSAVGLSFDPTHSTTTSAR
RRESSSDLINVPLDDFGPQEAEHYLSPTDTYEDTAPLTDHRFLQPISGASQNFSGGQDDR
GSTHGNRFPSDSRPESRLGDDLPHLESGLGRRRRGSSSAGDSRARSLSPSATGSALQRAG
SMMKSMSQRVVNLSNEPEVVEQAIMREEQHKNARLEEPPSLPSLSGYAHDAPSVGMSDDQ
LPRTGTSASKAWRMYNNPLRGKALGILGPNNLIRVWLCDILVHPFMEPFILVVIIIQTIL
LALESAKSVWDHPRSVRWGSNPMDYAYFVIFVIYTLELVAKILVSGFIINPAEYSTLDRS
MGLRKAIAEKGKNLLAPQRQFASKQQASSSPEPQQASIIRTFTGGFDQLQPEVIDDPLQP
RRVRLAHRAFLRHSFNRLDFVAVVAFWVSFLLSFTGVETHHQLYVFRMLSCLRILRLLAL
TNGTSVILRSLKKAAPLLVHVAFLIGFFWLLFAIVGIQSFKSSLRRTCRWLGRDNETDFD
LNDPYGTLQFCGGYLNVTTGAKEPWLKSDLTPSNGDAKGYICPQGSICVENTNPYGGTVN
FDNILHSLELVFVIMSSNTFSDILYYTTDSDYLAAALFFAFGIVILSLWLVNLLVAVITH
SFQVIREESKRSAFAVQKLDSLDTENTSTRKTSSFKRFYDRTEWLWIGIIILDLVVQAMR
SSTMEEDRANLINVVEVFVTIILLFEIILRFASDWRRFHRSRRNWVDLGLALITCVIQIP
AIKHSGRPYDVLTLFQILRVYRVVLAFSVTRNLIMVVFRNATGLLNLIMFVFLITFLASI
FATQLFRGQIPAENNGGDEIDINFADIYNSFLGMYQILSSENWTTMLYDATAFTYPFNTA
WISAIFIILWFIVANFIVLNMFIAVIQESFDVSEDEKRLQQVRAFLEQKQVTGNSQGNLS
LSKILMLGRDSNRYRDPLDHGPAALEMLLKDAVVREFLDEQEAPTESRRRDSAPLETAAA
ATAETVRPGVFSRWWTAITTSVLRREPNPFYSKLKFSRAYEELDPKEMAKEVVSAAEQRK
RAQREYLMRHPNYNKSLFIFAPDNPVRRLCQRIVGPGRGHQRVEGVDPYKPVWYTFSAFV
YAAIVAMVLIACITTPIYQRNYQVQWHGEAMPWYVYTDTGFAILFTIEALIKVIADGFFW
TPNAYFRGSWGFIDGIVLITLWINVGSSLFKDWGVSRAIGAFKALRALRLLNVSDSAKDT
FHSVIIVGGWKVIAAALVSVSFLIPFAIYGVTLYNGQMVKCNDGSIVGSLDQCINEYLSS
PYNWDVLAPRVASNPFYDFDNFGDALFILFQIVSQEGWIDVQNSAMSITGKDMQPQSFAA
PANGLFFIMFNLLGAVFVLTLFVSVFMRNYTEQTGVAFLTAEQRSWLELRKLLRQISPSK
RSLDRKSSKWKLWCYRIAVKKHGRWARCVTVILVLHLLLLVLEFYPEPYLWELTRQALFF
AFTFFYIANVLIRLLGLGWHRFSRSSWDLYSLVAVPGTFVTTILNYLLRNQVIMELNKLF
LVSITLLLIPRNNQLDQLFKTAAASLTAIGNLLATWFVLFLVYAIALNQAFGLTKFGGNE
NNNINFRDIPRALILLFRMSCGEGWNELMEDFATMVPPFCTYDSDFFNDDCGSAAWARPL
FISWNIISMYIFVSLFVSLIFESFSYVYQRSSGLYAISREEIRRFKQAWATFDPDGTGYI
TKEQFPRLLGELSGDFAMRIYDDEFTIGRILEKCRVDKRDSLIAHRRVVEGLDLDKLCRI
LRQIPVETVRKRRQRLNRFYEEVLVSADPVRGISFHSILMILAHYNVISDSKSLRLEEFL
RRRARLQRVEEAVRRNTVIGFFDTLYWSREFRRKVNAKKSSRMSEVPQFTVPEIFVDDGY
QEGSGTAEVGGGGSLGAPDAIVSGDEDTQPMLSPISPTRGPSSPTSSRQLPRLDTNLTGR
MSNVSSPTEWSSISPSLTPGGRERSHTLSSYDAGPDVPISPTGSNHSRENSAMNVQDVMQ
SLDDSAWGESIRRSFTQRRSNGSQP
Download sequence
Identical sequences B0XQN0 Q4WSZ4
Afu1g11110 XP_752476.1.65241 5085.CADAFUAP00006842 Afum_A1163:AFUB_010540.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]