SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Afum_A1163:AFUB_062900.t1 from Aspergillus fumigatus A1163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afum_A1163:AFUB_062900.t1
Domain Number 1 Region: 3-378
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-114
Family IF2B-like 0.000000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Afum_A1163:AFUB_062900.t1
Sequence length 387
Comment gene=AFUB_062900 DS499598:join(33458..33990,34045..34675)
Sequence
MASILQAIRYSHGKLAIIDQLQLPYVEKFITIRTSEDAWHAIKEMRVRGAPAIAIVAALA
LASELNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISGHADTP
GATGRTVAEAFIRAAEEMMTKDLDDNMKIGQNGAEWIIKHALARHKSTATVLTHCNTGSL
ATSGYGTALGVIRSLASKKALEHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMVAA
LLASTKAEVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLGTKS
GEDIVIEERPSAEVTKIRGPVDGDHPADIVKLETVHIAAKGIDVWNPAFDVTPSTLIDGI
ITEVGVIEKEADGQFHLERLFIDNSAS
Download sequence
Identical sequences A0A229Y5Y1 B0Y5C3 Q4WNI1
XP_752241.1.65241 5085.CADAFUAP00008095 Afu4g05830 Afum_A1163:AFUB_062900.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]