SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19704013|ref|NP_603575.1| from Fusobacterium nucleatum subsp. nucleatum ATCC 25586

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|19704013|ref|NP_603575.1|
Domain Number - Region: 69-129
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|19704013|ref|NP_603575.1|
Sequence length 200
Comment Ser/Thr protein kinase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
Sequence
MKKFRKENEVDDLDLDNLEFEEEVIEIEEKKDDKKKLAKIILNIVLILAIIKLGSNIFQR
YYFNEFYYKAPNLLGLNIDEAKKTISHSALNIREMGEVYSDLPYGTVALQEPSEGTIVKR
ARNIKVWVSKESPSVFLDDLVGMNYIEASSLLNKNGMKVGEVKRIKSDLPINQVIATSPK
SGEPISRGQKFDFLISNGLE
Download sequence
Identical sequences A0A0M5M9N4 D5RAU2 Q8RFL6
190304.FN0678 gi|19704013|ref|NP_603575.1| NP_603575.1.20138 WP_005902075.1.20223 WP_005902075.1.29770 WP_005902075.1.33975 WP_005902075.1.7230 WP_005902075.1.73842 WP_005902075.1.94488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]