SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19705025|ref|NP_602520.1| from Fusobacterium nucleatum subsp. nucleatum ATCC 25586

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19705025|ref|NP_602520.1|
Domain Number 1 Region: 60-132,161-371
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.28e-52
Family Patatin 0.041
Further Details:      
 
Weak hits

Sequence:  gi|19705025|ref|NP_602520.1|
Domain Number - Region: 661-700
Classification Level Classification E-value
Superfamily Ribosomal protein L6 0.0396
Family Ribosomal protein L6 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19705025|ref|NP_602520.1|
Sequence length 760
Comment serine protease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
Sequence
MKKIFFLLYIFLNFGFAYSENIELKSREDVEIENLESQIKVLEDKIQTIKKLKSAKDNKN
LKVALVLSGGGVKGYAHLGVLRVLERENIKIDYITGTSIGAFIGTLYSIGYTVDEIEKFL
DDVNVSNFLETITDNTNLSLEKKESLKKYSVHLSFDNELNFSFPKGLRGTGEAYLLLKGL
LGKYEHMDNFDNFPIPLRIIATNLNTGETKAFSKGDVAKILIASMSIPSIFEPMKIDGEI
YVDGLVSRNLPVEEAYEMGADIVVASDIGAPVVEKDDYNILSVMNQASTIQASNITKISR
EKASILISPDVKNISALDSSKKEELMKLGKVAAEKQIDKIKLLAKADNKKKKEKFVTNSD
AKIIINKIEYNDKFDKNTVIVLNDIFKGLLNNPISKKDIDKKIIDVYSSKYMDKVYYTVD
NGVLYLDGEKAHSNRIGVGANYQTGYGTTFNIGTDLFFNGKFGNNINLNFKFGDYLGADL
GTLTYYGVKNRFGILTNIGYNESPFFLYKNRRKFAKFMNREAYLNIGIFTQPTNNSMISY
GVLSKFSSLKQDTGDSLSQKLEYSENQTKTYIRFKYDNLDSISNPTKGIKADFIYNFASS
FGKSKSNLYGPAYSIKGYIPINPKLSFVYGLNSASLRGDRIRADQRIRLGGTYTNINNNE
FEFYGFNYQEKQVKDLISLTLGFKHKIVYSLYFNTKFNIATFTENNSFGNNNSRLWKNYS
KGMGISISYDSPIGPIEFSISSDLRHKRPIGSISIGYKLD
Download sequence
Identical sequences Q8R6F6
gi|19705025|ref|NP_602520.1| NP_602520.1.20138 WP_011015773.1.20223 WP_011015773.1.33975 WP_011015773.1.73842 190304.FN1704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]