SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19705273|ref|NP_602768.1| from Fusobacterium nucleatum subsp. nucleatum ATCC 25586

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19705273|ref|NP_602768.1|
Domain Number 1 Region: 4-211
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.59e-52
Family PP-loop ATPase 0.0000254
Further Details:      
 
Domain Number 2 Region: 362-440
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.37e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|19705273|ref|NP_602768.1|
Sequence length 448
Comment cell cycle protein MesJ [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
Sequence
MELFREILKLNKKYNLIENNDTIVVGFSGGPDSVFLVEMLKKLQYFFNFKIYLVHINHLL
RGEDADSDENFSFEYAKKNNLEIFIKRIPVKEIAKEVGKTLEEVGREERYKFFSEIYEKV
GANKIATAHNKDDQIETFLFRLIRGTSLQGLEGIKIKNNNIIRPISEIYKKDILEYLNKN
EIQYKIDKTNFENEFTRNSIRLNLIPFIEERYNIKFKDKIFSLIEEIRENNQNNSLNLSN
YTDSENRIILEKIKFLSDFDKKNLLSLFLNQKNIEVNRNKIDEINSLIKSNGTKKIDLDK
SYRIVKDYTHLYIEEKKENFTIVNRVVKLKIPSEQIFDDFKISVNIVKNLDIPKKKNQYL
LDALYNDIIEVRYRKEGDRIFLDEKHSKKIKEVFIDQKIPKDMRDRLPIFLYNNKIFWIY
NVKKAYIPKINKNESKLIKVLITVEEVK
Download sequence
Identical sequences Q8RHN5
gi|19705273|ref|NP_602768.1| NP_602768.1.20138 WP_011015953.1.20223 WP_011015953.1.33975 WP_011015953.1.73842 190304.FN1977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]