SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_02725T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_02725T0
Domain Number 1 Region: 10-325
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.02e-59
Family ADP-ribosylglycohydrolase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FOXG_02725T0
Sequence length 327
Comment | FOXG_02725 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (328 aa)
Sequence
MSHPERLSDHESRIIGALLGVHAGDSLGANLEFAPHDLIASDYPGGLRDLIGGGLLSWSA
GQATDDTDMTRAVLLAYRDFQPGDDITRLSAENFLKWEDGDWPGRELGSRPKDIGEAVAD
GLEKYRETRDPDHAGAGRGRAGNGSLMRCIPTGLFQTDPETLIVESERISRVTHDDKKCT
VSCAAYNTIVSQLINGSSAATAIAAGQHVAIALKSAQVNRAIELGKELSIATMAKKGASP
KLKDDGGGFVLDSLSIGIAALLDRRGLEDVLVDVVRIGGDTDTNAAISGGLLGARDGEDG
IPLRWRTKLQYGEEFKSIALGLLRRSL
Download sequence
Identical sequences A0A0D2XFN6
XP_018236400.1.49799 FOXG_02725T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]