SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_11578T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_11578T0
Domain Number 1 Region: 18-375
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.48e-55
Family ADP-ribosylglycohydrolase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FOXG_11578T0
Sequence length 441
Comment | FOXG_11578 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (442 aa)
Sequence
MTSIALSENAHKALEPLHLQDRIIGTIFGSALGDAIGLYTEFLSADISAKAYPDRKFTLL
PAEKATPFRRDHHRNFHRTGEWTDDTDHAVLILLSFLHSDGKKLDPQDFASRLSVWVRMG
LRALDTLPLGLGRTVGGIVRSKSYLNDPEGTARNFWVTGKYNAAPNGSLMRTHPLGLMCL
TKSVEETFQVAADFSVVTHVDPRCVVSCAIGTALVRGLVLGEVYEERHVDELIETGLTWY
NERREKELQDPDKKDEPRLDVEEFKKHATAQSLADLKLDESYKIGYVYKTFGSGILLLRL
ALRQLKSSGQLCSQLAIFEKLITDLTMEGGDADTNACFAGALLGALLGYKSLPPHWRDGL
RHGTWLMEKSEGLCDVLGVTKGSYFGSRDKDTAEDGGRGFLTDAQMEEKCMRMQAWMAQE
ETEWKKKQEIEKKKPNWFPWK
Download sequence
Identical sequences A0A0D2Y5M2 X0A9W5
XP_018249878.1.49799 FOXG_11578T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]