SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_14324T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FOXG_14324T0
Domain Number - Region: 9-77
Classification Level Classification E-value
Superfamily CinA-like 0.0301
Family CinA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FOXG_14324T0
Sequence length 108
Comment | FOXG_14324 | Fusarium oxysporum f. sp. lycopersici predicted protein (109 aa)
Sequence
MAGQHVETTNHQAESSQTVESAAENVQTWPENSSLADTGETGPDAILFGELSIAPSQEDE
DLGTIDIGPAYYDKEPVDARSAGGRENQTESGSPDAVTQVKFDCNGEL
Download sequence
Identical sequences A0A0D2YDE0
FOXG_14324T0 FOXG_15156T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]