SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_15429T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_15429T0
Domain Number 1 Region: 8-328
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.03e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.000000209
Further Details:      
 
Domain Number 2 Region: 440-536
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.57e-40
Family D-aminopeptidase, middle and C-terminal domains 0.00011
Further Details:      
 
Domain Number 3 Region: 354-431
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00000654
Family D-aminopeptidase, middle and C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FOXG_15429T0
Sequence length 536
Comment | FOXG_15429 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (537 aa)
Sequence
MPVSKEIVQDILKAIPARIRGPGGAVAVLSDGALVDQRVWGYADFNRRIPMTDDTLIPIC
SISKQMLCGLVADLEKNPTPKLAEKGDVKTQFEEKLKEILPELAKTGELKIDHLCNNRSG
IRDYWAITLLWGAKPEDPYSIAEHNEKVLKTIKSTHFTPGTEYSYCNTNFNIVARVVEAT
TKESLSDLLNARIFRPAGMKTAQLGADTAKLPPPCVGYEGDEDRGYIPAENRIEWAGDAG
IIASLGDMIAYESFLDRSLFDPNSWYRAIFKPTPFTDGVPSIYSQGLGHSQYGSVSGIGH
GGALRGFRLYRAHVPEERLSVVAMFNHEADAATLVEHIIQTTLALQKPPPPTLVDASPAW
PGIYLDDGTQLAVTIKNGKKGQIVVNYANYAEPVNLTDPERGESRAMVAVVDGDNLRIHR
LKENRTLNAKRLKIGDTPVDNSAFTGDFYSEEIGSIFHCVDQGGLMFGTFEGFLGHSPAQ
FMRYLGGDVWALANPRGMDAKPPGDWTLVFHRDEKGAFVGVTIGCWLARKIEFVKK
Download sequence
Identical sequences A0A0D2YGI8
FOXG_15429T0 XP_018255411.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]