SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_11305T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_11305T0
Domain Number 1 Region: 35-715
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-233
Family Motor proteins 0.000000000157
Further Details:      
 
Domain Number 2 Region: 1031-1123
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-22
Family SH3-domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FOXG_11305T0
Sequence length 1186
Comment | FOXG_11305 | Fusarium oxysporum f. sp. lycopersici myosin-5 (1187 aa)
Sequence
MGISRRPKNKGAGAAADGASGGAKPKKATFETTKKKEIGVSDLTLLSKVLESYMGKNRLE
MPPHVFAIAEAAYYNMKAYSDNQCVIISGESGAGKTEAAKRIMQYIASASGGESGDIKQI
KDMVLATNPLLESFGNAKTLRNNNSSRFGKYLQIYFNAQGEPVGADITNYLLEKSRVVGQ
ITNERNFHIFYQFAKGASQQYRETFGVQKPETYVYTSRSKCLDVDGIDDLAEFQDTLNAM
KVIGLTQAEQDEIFRMLAAILWIGNIQFQEDQGGYAEVIDRSVVDFAAYLLEVTPDQLIS
GITIRILTPRNGEVIESPANPAQAQATRDALAMAIYSNLFDWIVERINKSLKARQPTTNT
IGILDIYGFEIFEKNTFEQLCINYVNEKLQQIFIQLTLKAEQEEYAREQIQWTPIKYFDN
KVVCDLIEQIRPVGIFSAMKDATKTAHADPAACDRTFMQSINGMSHAHLTPRQGNFIIKH
YAGDVTYTVEGITDKNKDQLLKGLLNLFQHSGNQFVHTLFPRPVDQDNRKQPPSAGDRIR
ASANALVDTLMKCQPSYIRTIKPNENKSPTEYNSPNVLHQIKYLGLQENVRIRRAGFAYR
QDFDKFVDRFFLLSPATSYAGEFTWEGTTEAAVKQILKDTSIPKEEWQMGVTKAFIKAPE
TLFALEHMRDRYWHNMATRIQRMWRAYLAYRAESATRIQRFWRKKRTGAEYLQLRDHGHQ
VLGGRKERRRMSLLGSRRFLGDYLGVNASTGPGAQIRNAASIGTNEKAVFSCRAEILEAK
FGRSSKASPRIIVVTTNKFYIIAQMLVNGHPQISVEKAVPLGAIKFIGASSARDDWFSLG
IGSPQEPDPLMNCMLKTEMFTQMQRVMPGGFNLKIAETIEYAKKPGKMQQVKVLKDSQLP
VDYYKSGAVHTQPGEPPSSVSRPTPKGKPVPPRPITRGKLIKPGGPNGRPSRIQGNRTAK
PRPGAGRAVPQPPAAVSNIAAVPAAATQSTPRIAPRPGANAAAPIPAAHNALPSHTRNAS
GAGRAPPPPPPPAVAARPPSPPKVMAKVLYDFAGQRENELTITANEIVEIVQKESNGWWL
AKNPQTAQQAWVPAAYVEEQAPPAPRAPPAPPRSKPTPPAPPAKRPAANRKPAELQQRDS
GMSLNTPNGGDSRSSTPTPSLGGSLADALLARKNAMQKEKEDDDDW
Download sequence
Identical sequences A0A0D2Y4V1
FOXG_11305T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]