SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FOXG_12299T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_12299T0
Domain Number 1 Region: 51-170
Classification Level Classification E-value
Superfamily E set domains 0.000000588
Family Arrestin/Vps26-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FOXG_12299T0
Sequence length 391
Comment | FOXG_12299 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (392 aa)
Sequence
MTGLSQLIRPQSLAPPLFKKRSQKSPNRPPASLDCQIDTSPIVIVNDDATDGSTISGSLL
FNVEEAIEVDSLFATLRVHVVNRKPFKRTCKACKHQVIELKRCHFITTTTSLDCNNYTYP
FSYQVPSYVPPSMDTSLVSVTYEFQAVTYIRRTGSLSKLPEIITLNRTLPVARSIPVPSK
PLLSTRIYQAAGIEVGCSFDLVLDPSGKNYVKLTISGLRSCPDNGEDIQFWRVCKGTWML
QENIKSTAVACSQHAQECQADEKSHAQKKTITIGESSFYDGWTTDDAAGTLSMEFPFFIK
KASRFTQDTGDVGDTSVTHSLVLELQLMKEIYPQGNPDLSVRSGVGRILRSEHRVVLSDF
ARPSDHVEEESLPCYSDLRPGPPLYQEKDSE
Download sequence
Identical sequences A0A0D2Y7N4
XP_018250844.1.49799 FOXG_12299T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]