SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189345609|ref|YP_001942138.1| from Chlorobium limicola DSM 245

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|189345609|ref|YP_001942138.1|
Domain Number - Region: 149-205
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 77-102
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189345609|ref|YP_001942138.1|
Sequence length 301
Comment protein PASTA domain-containing protein [Chlorobium limicola DSM 245]
Sequence
MQSATVYKRAMHALAVIPILLVFAGCCGSRPIIADPASPLSPNIADNLRPATVVVIEPDG
PRRPSTPASIPDHQPRKTAMRVPNLVGLPLDSAKTLLRQKKLITGKIDVMRHSGKAGLIL
AQNPPYGQQLPIREGSAVDLTVSVPVIADIPDVTGKSLHEARSAIENAGFAIGTVRPDSL
GAEATVAGQSPTPGKRMEKGTAIDLRLKPADASLPPVNPELLTIGLLAAGGGALLWNRMR
KQSYPGKKREAAAVTPRMDYGNQEFRAPSGLSGKHDASIGFLHDTGVQEIRFRKPPTITS
D
Download sequence
Identical sequences B3EDS9
WP_012465040.1.84751 290315.Clim_0051 gi|189345609|ref|YP_001942138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]