SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189345960|ref|YP_001942489.1| from Chlorobium limicola DSM 245

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189345960|ref|YP_001942489.1|
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Folate-binding domain 3.3e-99
Family Aminomethyltransferase folate-binding domain 0.000000595
Further Details:      
 
Domain Number 2 Region: 275-361
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 8.83e-18
Family Aminomethyltransferase beta-barrel domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189345960|ref|YP_001942489.1|
Sequence length 362
Comment glycine cleavage system aminomethyltransferase T [Chlorobium limicola DSM 245]
Sequence
MKKTALYSWHEQAGAKIIDFGGYLMPVQYSGIIAEHKAVREAAGLFDVSHMGNFYVRGVR
AGEFLQYLTTNDLSKVSDGEAQYNLMLYTDGGVVDDLIIYRIDAETYFLIVNASNAQKDY
AWIQKHIGAFEGVSLEDRTDELSLVALQGPMSGAILRKVFPDEDCNTLASFRFRKVYYNG
TELLIARTGYTGEQGVEICLPNEAALELWSVLMKAGEEYGIQPIGLGARDTLRLEMGYSL
YGHEIDSTVNPLEARLKWVVKMEKGPFIGKEACRQVELNPRYAVAGFSLDGRALPRQHFR
LYNSDRQEIGTVCSGTLSPTLQEPIGTCSILREYSRPGTHVMVEIRGTMHQGVIRALPFV
QR
Download sequence
Identical sequences B3EFX7
gi|189345960|ref|YP_001942489.1| 290315.Clim_0417 WP_012465391.1.84751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]