SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189347976|ref|YP_001944505.1| from Chlorobium limicola DSM 245

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189347976|ref|YP_001944505.1|
Domain Number 1 Region: 247-582
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.22e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.0000281
Further Details:      
 
Domain Number 2 Region: 57-246
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.79e-35
Family Penicillin binding protein dimerisation domain 0.0034
Further Details:      
 
Domain Number 3 Region: 608-664
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000549
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189347976|ref|YP_001944505.1|
Sequence length 673
Comment peptidoglycan glycosyltransferase [Chlorobium limicola DSM 245]
Sequence
MSDRDFPERPGDAEFAKRLGIVVLLFIAFLGAIIAMLLNIQVINVRKYQEKAEKQYVRVV
TEKAQRGVILDRQGRMLAETVETISFYADPEKVRHTPLVDENGTAVLDKKTRKQKTFDNS
REVAALFSEKLGKSRREYLKKLRRGKRVVVLGRKIPAAQALPLMQQPIHGVWSDREQQRY
YLNVAAQVIGVTDSKNSGISGLELQFDRELKGRDGSRIFQRLATGKKYPAPDALQQEPRK
GHTVQLTLDADIQSIVEDELAAAVGTFQANAATGIVLDVRTGEVLAMANNPTFDLNRRVT
WTPEKARNRSVTDSFEPGSTFKLVMAATATEVLKRRAEDNVFAHNGVLPLYGLRIRDHEP
YGTITFREAIMHSSNVVAAKTAMETGKKTFYSYTKKFGFGSKTGVGLIGESQGRVRALKN
WDRTTLPWMGYGYQVMVTPLQILQAYAAVANDGVLMRPYIVRRITDDQDRTVRENQPQKV
REVVSPATARYMGREYFKAVVDSGTARTAAIPGMSVAGKTGTARRAAGGSYANAVYVSSF
VGYFPVESPRYAMIVLVEEPRTAYYAATVAAPVFSKISSRILACSEELQKNLSFRSPEQS
LLDSTKTVAVPELKGMKGRDAQRVLKWLGLEMELSGGVDGVVTSQNVPPGTKVEKTRVIR
VGLSSKTPKRAFL
Download sequence
Identical sequences B3EIL4
gi|189347976|ref|YP_001944505.1| WP_012467390.1.84751 290315.Clim_2508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]