SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219669935|ref|YP_002460370.1| from Desulfitobacterium hafniense DCB-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219669935|ref|YP_002460370.1|
Domain Number 1 Region: 266-311,355-445
Classification Level Classification E-value
Superfamily TPR-like 0.00000000928
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  gi|219669935|ref|YP_002460370.1|
Domain Number - Region: 12-54
Classification Level Classification E-value
Superfamily Vng1086c-like 0.0876
Family Vng1086c-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219669935|ref|YP_002460370.1|
Sequence length 495
Comment hypothetical protein Dhaf_3919 [Desulfitobacterium hafniense DCB-2]
Sequence
MSYSIITEYSNQLHQLLVSVSQHLYFDKDGYVTYQKKPLGVNIKSCHKSRKEHLVYYVLR
DHFSGTFTFQIATTKRLIPLADFLHYAWSEPKGEEKFIWGMPDSLFIPQMIASEELLSGL
EALNVRPLHPPSGFASGVRVIRDIENDLCFFMRETVDYSLEGLNKLRFRVYQYLINSSHR
DNKFSNWKAGLTYQSHPRITPVYSDFVNFFPADDPKAPSPIPLNQVPKDKQLEKRTRKSK
KATPDYPPFSEEKLSHAQELIYDAWEEPNRQKCLALARKALRISPYCADAYTLLAEKCEL
LKERQELYTKGVEAGRMALGDSFFQEESGHFWGYLKARPYMRALAGLSECLWKNGLRQEA
IESYKELLRLNPNDNQGIRYILINCLLAEGLDGEAEKLLSTYPESSCFMLYSKALLSFRR
LKHRKAEASLKEALLSNPHVPPYLLGSKHLPWPLPAYYSPGSIEEAVIYAADACTVWKNT
PNALTWLTEKLKSIT
Download sequence
Identical sequences A0A0W1JE40 B8FSE6 Q24TV0
DhR41 WP_011460574.1.13927 WP_011460574.1.80252 WP_011460574.1.88067 WP_011460574.1.94859 gi|89895499|ref|YP_518986.1| gi|219669935|ref|YP_002460370.1| 138119.DSY2753 272564.Dhaf_3919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]