SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|365974303|ref|YP_004955862.1| from Propionibacterium acnes TypeIA2 P.acn33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365974303|ref|YP_004955862.1|
Domain Number 1 Region: 125-245
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.31e-23
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.54e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|365974303|ref|YP_004955862.1|
Sequence length 257
Comment succinate dehydrogenase/fumarate reductase iron-sulfur subunit [Propionibacterium acnes TypeIA2 P.acn33]
Sequence
MKINLRIWRQRNSKDQGRLVEYTLDGVSGDMSFLEMLDMLNENLTAQGEEPVAFDSDCRE
GICGQCGVVINGVPHGGMGAAQPVRTTTCQLHMRSFADGSTITIEPWKSGAFPILRDLIV
DRSALDRVIQAGGYVSVNTGAAPDAHAVQVNKKRSDRSFDAATCIGCGACVAACPNGSSM
LFTSAKITHLAMLPQGQPERMRRVKAMAAQNDAEGFGGCTNIGECASVCPKGIPLESISQ
LNRDLIASLFKHDGKDD
Download sequence
Identical sequences A0A1J4WY65 A0A1N4ZY34 A0A2I1VYG4 Q6A7T0
267747.PPA1437 WP_002518371.1.101196 WP_002518371.1.102089 WP_002518371.1.17579 WP_002518371.1.18363 WP_002518371.1.22959 WP_002518371.1.26893 WP_002518371.1.26956 WP_002518371.1.28533 WP_002518371.1.31624 WP_002518371.1.3428 WP_002518371.1.37742 WP_002518371.1.43449 WP_002518371.1.43585 WP_002518371.1.44257 WP_002518371.1.45324 WP_002518371.1.48202 WP_002518371.1.49294 WP_002518371.1.50101 WP_002518371.1.50533 WP_002518371.1.51523 WP_002518371.1.53219 WP_002518371.1.5458 WP_002518371.1.56454 WP_002518371.1.59251 WP_002518371.1.59982 WP_002518371.1.60667 WP_002518371.1.67054 WP_002518371.1.67213 WP_002518371.1.67247 WP_002518371.1.69974 WP_002518371.1.72191 WP_002518371.1.74746 WP_002518371.1.767 WP_002518371.1.80166 WP_002518371.1.81031 WP_002518371.1.81478 WP_002518371.1.87452 WP_002518371.1.89010 WP_002518371.1.90935 WP_002518371.1.98061 gi|387503813|ref|YP_005945042.1| gi|365974303|ref|YP_004955862.1| gi|50842916|ref|YP_056143.1| gi|365963129|ref|YP_004944695.1| gi|365965369|ref|YP_004946934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]