SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325294827|ref|YP_004281341.1| from Desulfurobacterium thermolithotrophum DSM 11699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325294827|ref|YP_004281341.1|
Domain Number 1 Region: 203-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-70
Family B3/B4 domain of PheRS, PheT 0.00000748
Further Details:      
 
Domain Number 2 Region: 38-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.59e-47
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 470-689
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.39e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 4 Region: 697-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.41e-29
Family Anticodon-binding domain of PheRS 0.00021
Further Details:      
 
Domain Number 5 Region: 405-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000033
Family Domains B1 and B5 of PheRS-beta, PheT 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325294827|ref|YP_004281341.1|
Sequence length 794
Comment phenylalanyl-tRNA synthetase beta chain [Desulfurobacterium thermolithotrophum DSM 11699]
Sequence
MRITYNWLKEFINIEDLSAQEIANILTDVGIEVDSVRYAAENLEKVVTGKIVEITKHPNA
DKLKICQVDVGNEVLQIVTGADNVFEGAVVPVALHGSKLPIGVRIKRSKLRGVVSNGMLC
SEEELGLTDSSSSGIMILPDNVEIGKDVKEVLSLDDWIIEYEITTNRPDALSILGIAREL
KAVLNRPVKLPQNDFKEGNFEAKEEASLSVLDSGACLRYDGFILKGIENKPSPLFMQIRL
YLVGLRPINAVVDVTNYVMYELGQPLHAFDLEKLSGREIIVRRAKDGETIVTLDGVERKL
TQDDLVIADAEKAVAVAGVMGGEESGTSLSTKNIFLESAHFEPMTIRKTSKRLSLSTDSS
YRFERGADIEITEFAARRALHLIQKFCGGKVAKGKLSFYPKPYTPKVIVFNPEKSTKILG
VNIPPRKSFEILANLGFTVKKEQNYIVVKVPSWRKYDVAREIDLIEEIVRIYGMKNVIST
YPLMHTDVNKNLEYDKLNEVKEFLTAFSLNEAINYSFIGEKLYRFFGLSVENLIKISNPL
SEEWVYMRDKIFPSLVQNAVLNINRNEKDVFLFEIAKIFENKGEKLPEEHLHLGILLTGK
IPEGILSEREVDFYDLKGIVEGLLELLKLEGKFESLDNVEYLHPGQSAKVIVNEKEIGFI
GKLHPDVLERLDIKQDVFVGELSLDRLLEFSKEREIFFKQIPKFPPVTRDIAVLVDADMP
VGKLEEVIKSSAKYLEKLKLFDLYKGKGIPEGKKSVAFSLVFRSKEKTLSDEEVNKILNG
IIKALEKFGATLRA
Download sequence
Identical sequences F0S360
WP_013638239.1.33556 gi|325294827|ref|YP_004281341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]