SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325295220|ref|YP_004281734.1| from Desulfurobacterium thermolithotrophum DSM 11699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325295220|ref|YP_004281734.1|
Domain Number 1 Region: 8-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-60
Family PP-loop ATPase 0.0000259
Further Details:      
 
Domain Number 2 Region: 360-430
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000418
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 210-310
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000785
Family MesJ substrate recognition domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325295220|ref|YP_004281734.1|
Sequence length 454
Comment tRNA(Ile)-lysidine synthase [Desulfurobacterium thermolithotrophum DSM 11699]
Sequence
MLKDKVENTIKNFSLISENSKVLVALSGGPDSVTLLHILLQLKEKLKIDIAAAHLNHMLR
GEESERDENFVKKLCSDWGIPLFTKRENIKEISKGKNIEAVAREVRYRFLEETLKKINGD
YIATGHTASDLVETVILNLTKGTGIKGFRGFFPKREKIIRPLFEVTREEIENYIKENNIP
FVVDSSNLKTEFERNLIRIEVIPVLKKINPKLEEAVLRNTSILREIEDYINKEVENLLRK
YLSKNQFCIPLEKLKKLEPVLRKELLIKVFKTITGRTLSYKKLEFIENVIKKKEYKELKL
TRGYVIFKDQENFCIEKENGKEKEYFIEIKEIPSKVETPMGIVEFDLWDGKEEGFLIPYK
EAISKGIVVRNRRPGDRLSFKNFSKPLKKVFIEKKIPVKKRNILPIVQVGDKIVWIPGVY
KAYINFIPNEKQIVVRLKSGDRGSNTRKFTQKES
Download sequence
Identical sequences F0RZZ4
gi|325295220|ref|YP_004281734.1| WP_013638627.1.33556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]