SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325294819|ref|YP_004281333.1| from Desulfurobacterium thermolithotrophum DSM 11699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325294819|ref|YP_004281333.1|
Domain Number 1 Region: 201-339
Classification Level Classification E-value
Superfamily CBS-domain pair 4.3e-32
Family CBS-domain pair 0.0015
Further Details:      
 
Domain Number 2 Region: 338-419
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.36e-20
Family CorC/HlyC domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325294819|ref|YP_004281333.1|
Sequence length 421
Comment hypothetical protein Dester_0623 [Desulfurobacterium thermolithotrophum DSM 11699]
Sequence
MESDNLTIYYIALPILVLLSGLFSASETAFFSLNTLRLERLAREGNRKAEEILKFLQNPA
NLIATILVGNEMVNIAIAATSATLFVKLLGKELGATLSVPITVVILLIFGEVTPKTLAIK
YSERYAFFILSFIKLVSILIAPFRLIFVKFASILLKPFGIELFNKPKVLTDEEFMILVSE
GAEEGTIATEEKELIDRTLDLGETDVKEIMVPKHKIFAIQKDTPVKEAIEKIKKTKFSRI
PIYDNSLDEIVGVLYTRKILPLRLNPEDLEKPVSHFIDKPYFVTEFLTLDRLLEEMQRSK
KHMAIVIDEYGNTAGLVTLDDILTEIVGEIPDEKKITEEIKKISENKYLISGDTSIEEIK
ELLNLEEDPVLEEVDTVAGLIMALTKRIPIKGESITYKGYKFTVDEMEGNRITSVIVEKE
K
Download sequence
Identical sequences F0S352
gi|325294819|ref|YP_004281333.1| WP_013638231.1.33556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]