SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325294820|ref|YP_004281334.1| from Desulfurobacterium thermolithotrophum DSM 11699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325294820|ref|YP_004281334.1|
Domain Number 1 Region: 201-333
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-32
Family CBS-domain pair 0.0019
Further Details:      
 
Domain Number 2 Region: 340-413
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.91e-16
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325294820|ref|YP_004281334.1|
Sequence length 415
Comment hypothetical protein Dester_0624 [Desulfurobacterium thermolithotrophum DSM 11699]
Sequence
MEGWALFLILLCVLSEGFFSGSEIAIVSLPKVELKKRLQKGDKAAKLLNKLLSEPEKLLT
TTLIGTNLSTVTGSTIYATLILGDIIKVFPQLSAYPEIVTVLTFTPITLTFGELIPKSLF
QKYSHQIAFKIVYPIYLFYYLFKPISFVVITFAKTFAKLVGAESEQNPFVTKEELQLLVE
SSSRFPVEKTERNILKNILKLREKTVGDIYVPLLNVVAVNENAPVKSALSLLEKSGFSKL
PVYRKRFDDIVGYISIGDLLNTESGEISVKELMRPILVFPEYMSIFDALKEFRKSSDQMA
IVVDEYGSTLGILTLEDILEEIVGRIEDEFDKSKLSITKKGNEILADGSVEIEELNKLLK
KPLPKSPDYVTVAGLILSKLGRFPKKREKIDLETAEIIVEDVEKKRIKKVKVKEK
Download sequence
Identical sequences F0S353
WP_013638232.1.33556 gi|325294820|ref|YP_004281334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]