SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|30064424|ref|NP_838595.1| from Shigella flexneri 2a str. 2457T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30064424|ref|NP_838595.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.2e-109
Family FMN-linked oxidoreductases 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.29e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000316
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.000000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30064424|ref|NP_838595.1|
Sequence length 672
Comment NADPH dehydrogenase [Shigella flexneri 2a str. 2457T]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRTVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADIVSMARPFLADAELLSKAQSGRADEINTCIGCNQGCLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A127GPQ1 A0A226KER3 D2A805 Q83Q36
gi|24114376|ref|NP_708886.1| gi|30064424|ref|NP_838595.1| gi|384544679|ref|YP_005728743.1| 198214.SF3121 198215.S3328 NP_708886.1.23235 WP_000121487.1.101522 WP_000121487.1.101545 WP_000121487.1.101667 WP_000121487.1.10361 WP_000121487.1.11912 WP_000121487.1.12965 WP_000121487.1.13157 WP_000121487.1.17711 WP_000121487.1.19024 WP_000121487.1.19148 WP_000121487.1.19453 WP_000121487.1.20484 WP_000121487.1.22409 WP_000121487.1.22522 WP_000121487.1.22771 WP_000121487.1.22896 WP_000121487.1.23622 WP_000121487.1.2395 WP_000121487.1.2433 WP_000121487.1.24547 WP_000121487.1.25038 WP_000121487.1.25799 WP_000121487.1.26005 WP_000121487.1.27472 WP_000121487.1.2931 WP_000121487.1.30640 WP_000121487.1.3176 WP_000121487.1.35368 WP_000121487.1.35649 WP_000121487.1.36129 WP_000121487.1.37155 WP_000121487.1.37549 WP_000121487.1.37637 WP_000121487.1.37730 WP_000121487.1.38119 WP_000121487.1.38202 WP_000121487.1.39063 WP_000121487.1.41391 WP_000121487.1.41449 WP_000121487.1.41513 WP_000121487.1.43561 WP_000121487.1.44222 WP_000121487.1.4445 WP_000121487.1.44627 WP_000121487.1.44671 WP_000121487.1.4535 WP_000121487.1.45392 WP_000121487.1.45799 WP_000121487.1.45949 WP_000121487.1.46429 WP_000121487.1.47775 WP_000121487.1.4953 WP_000121487.1.51206 WP_000121487.1.51736 WP_000121487.1.52406 WP_000121487.1.5291 WP_000121487.1.54989 WP_000121487.1.55070 WP_000121487.1.56358 WP_000121487.1.57150 WP_000121487.1.57348 WP_000121487.1.58136 WP_000121487.1.59165 WP_000121487.1.59226 WP_000121487.1.60342 WP_000121487.1.63350 WP_000121487.1.63554 WP_000121487.1.63612 WP_000121487.1.64153 WP_000121487.1.64793 WP_000121487.1.64930 WP_000121487.1.65484 WP_000121487.1.66059 WP_000121487.1.66978 WP_000121487.1.6701 WP_000121487.1.67412 WP_000121487.1.69404 WP_000121487.1.69868 WP_000121487.1.70191 WP_000121487.1.70251 WP_000121487.1.70341 WP_000121487.1.71158 WP_000121487.1.71724 WP_000121487.1.72342 WP_000121487.1.72449 WP_000121487.1.74509 WP_000121487.1.75124 WP_000121487.1.75505 WP_000121487.1.76447 WP_000121487.1.76460 WP_000121487.1.76957 WP_000121487.1.77198 WP_000121487.1.78377 WP_000121487.1.80463 WP_000121487.1.80966 WP_000121487.1.81876 WP_000121487.1.82507 WP_000121487.1.83286 WP_000121487.1.83321 WP_000121487.1.83340 WP_000121487.1.84164 WP_000121487.1.84986 WP_000121487.1.85008 WP_000121487.1.85416 WP_000121487.1.86483 WP_000121487.1.89998 WP_000121487.1.90065 WP_000121487.1.90314 WP_000121487.1.92123 WP_000121487.1.93605 WP_000121487.1.95254 WP_000121487.1.95712 WP_000121487.1.96128 WP_000121487.1.96608 WP_000121487.1.96680 WP_000121487.1.96769 WP_000121487.1.96932 WP_000121487.1.97279 WP_000121487.1.97815 WP_000121487.1.98323 WP_000121487.1.99119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]