SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56707459|ref|YP_169355.1| from Francisella tularensis subsp. tularensis SCHU S4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56707459|ref|YP_169355.1|
Domain Number 1 Region: 3-457
Classification Level Classification E-value
Superfamily L-aspartase-like 2.2e-147
Family L-aspartase/fumarase 0.000000000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56707459|ref|YP_169355.1|
Sequence length 463
Comment fumarate hydratase [Francisella tularensis subsp. tularensis SCHU S4]
Sequence
MRRVETDSTGQIEVDNDKYWGAQTQRSIEHFSIGSDLMPIEVIKALAIIKKAAAITNHQL
GILARTKKEIIIKVADEIIAGELDEHFPLRVLMTGSGTQSNMNVNEVISNRAIELLGGKK
GSKNPIHPNDDVNMSQSSNDTFPSAMYIATALEINNRLLPALEYMQQQLADKAKQWDDIV
KIGRTHMQDAVPLTLGQEFSGYAALLENNIQRIKDTLKYVYQLALGGTAVGTGLNAPDGF
AEITAKYIATITSLAFVSATNKFEVQGSHDALVAVMGQLKTLANSLFKIANDIRLLSCGP
RAGFHELLIPENEPGSSIMPGKVNPTQCEAMAMVAAQVIGYDVAVGIGGSAGYLEMNVYK
PLIIFNIIQSIKIISDSCVNFTKYLLEGMKPNHDKIEFYLKNSLMLVTALSPVIGYDKAA
KLAHYAEQKNISLAEANQELKFLSKEEFDKVVDPYKMTKGGIL
Download sequence
Identical sequences A0A0E2ZMN6 A0A0G2RMS6 Q5NHY7
177416.FTT_0306 393115.FTF0306 gi|110669930|ref|YP_666487.1| gi|56707459|ref|YP_169355.1| IDP02169 gi|379725332|ref|YP_005317518.1| gi|385794068|ref|YP_005830474.1| WP_003021628.1.101979 WP_003021628.1.10388 WP_003021628.1.11695 WP_003021628.1.17073 WP_003021628.1.1833 WP_003021628.1.19035 WP_003021628.1.2301 WP_003021628.1.25812 WP_003021628.1.26192 WP_003021628.1.26690 WP_003021628.1.31410 WP_003021628.1.35965 WP_003021628.1.36081 WP_003021628.1.3831 WP_003021628.1.38368 WP_003021628.1.38474 WP_003021628.1.38662 WP_003021628.1.39861 WP_003021628.1.40634 WP_003021628.1.44744 WP_003021628.1.47286 WP_003021628.1.52816 WP_003021628.1.5563 WP_003021628.1.56738 WP_003021628.1.5829 WP_003021628.1.59625 WP_003021628.1.60146 WP_003021628.1.61154 WP_003021628.1.65967 WP_003021628.1.66077 WP_003021628.1.66092 WP_003021628.1.67317 WP_003021628.1.75261 WP_003021628.1.77053 WP_003021628.1.80616 WP_003021628.1.82545 WP_003021628.1.87851 WP_003021628.1.98147 YP_169355.1.84429 gi|379716650|ref|YP_005304986.1| gi|379716728|ref|YP_005305064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]