SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73668037|ref|YP_304052.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|73668037|ref|YP_304052.1|
Domain Number - Region: 49-146
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0445
Family TRAPP components 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73668037|ref|YP_304052.1|
Sequence length 170
Comment hypothetical protein Mbar_A0490 [Methanosarcina barkeri str. Fusaro]
Sequence
MSFKSFLLKRLIIWDFIPYSLRWKKSVSGIGIIYVGTLEMMQEKYGKDGVSNLNETMYNI
GLGQSTEILKTLGLKRDLDGCAYVLLAMHRIFGIKSKIIHKDDNKIVIHARKCRWGGHLK
KWNVRTCLSIDNYEAGLIEGILPSSEHTYTKRRSCGDNVCELVISFSDSN
Download sequence
Identical sequences A0A0E3LKM2 Q46F70
269797.Mbar_A0490 gi|73668037|ref|YP_304052.1| WP_011305524.1.36239 WP_011305524.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]