SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73668217|ref|YP_304232.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668217|ref|YP_304232.1|
Domain Number 1 Region: 4-444
Classification Level Classification E-value
Superfamily L-aspartase-like 8.48e-125
Family L-aspartase/fumarase 0.0000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73668217|ref|YP_304232.1|
Sequence length 448
Comment Adenylosuccinate lyase [Methanosarcina barkeri str. Fusaro]
Sequence
MLIHPIDYRYGTAEMKHVWSQENRLNKLLQVEAALARAEADMGLIPADSAEIISESISSV
KAERVDEIEAEIHHDMMAVVTAISEQCRDDAGKWVHFGATSNDILDTATALQIKDAIDLM
EDKLKTLLGVLLDKAEAHKNTVCCGRTHGQIGVPTTYGLRFAIWASEISRHLERLHQLTP
RATVGQMTGAVGTQAAFGKSGILIQKLTMQYLGIGAVDVSNQIIQRDRHAEFVMWMANTV
TTLDKIGIEIRTLQRSEIAEIEESFGKKQVGSSTMPHKRNPIKSEQMCGLARIVRAMVEP
ELLNNTLWDERDLTNSSSERVVFPEACVLTDHILKIGINVIEHLRFYPENIRRNLELLRG
LNMGEAVMIELAKRGVGRQEAHELVRTAAMKAHDTGQHFKNVLLETPDIARYLTATYIEN
LVNPDKYIGTAVEQVEVLVAKLREAYSL
Download sequence
Identical sequences Q46EP0
269797.Mbar_A0673 gi|73668217|ref|YP_304232.1| WP_011305702.1.36239 WP_011305702.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]