SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73668955|ref|YP_304970.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668955|ref|YP_304970.1|
Domain Number 1 Region: 98-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.93e-59
Family Formate/glycerate dehydrogenases, NAD-domain 0.00001
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.51e-39
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 316-445
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 7.06e-34
Family SerA intervening domain-like 0.001
Further Details:      
 
Domain Number 4 Region: 442-520
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000404
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73668955|ref|YP_304970.1|
Sequence length 523
Comment D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str. Fusaro]
Sequence
MKVLVSDSLSNEGLEILKEHFKVDVSTGLSEDELVKKIKDYDALVIRSGTHVTQKIIEAA
DNLKIIGRAGVGIDNVDVDAATKKGIIVANSPEGNMISAAEHTIAMMMAMSRNIPQANAS
LKGKEWKRSKFTGVEVKGKTLGIIGLGRIGSEVAKRASGLEMNLMGYDPFVSEKRAIELG
VKLATVNEIAKEADYITVHTPLIKETRNILDEEQFALMKPTTRILNCARGGIINEEALAK
ALESGKIAGAAIDVFIEEPPFNSPLLSFDNVVVTPHLGASTKEAQVNVAVDIAKEVASVL
TGGPAKNAINIPSVKPEAMAVLAPYIRLSEIMGKIAGQLVDGNYEKVEIGYNGEISGKDT
RPLTVSALKGLLEMALGSGVNYVNAPTLAKSRMIAVVESKSESSEEYSSTISIKLSSNGK
EKLVAGTVVGDDPKIVAVDDDRVDIFPAGRMIFAKHINRPNVIGPCCMVLGKNNINISGM
QVGRSEIGGVTMMVLNIDSEVSDPILEEVRKVDGILDAKLVTL
Download sequence
Identical sequences A0A0E3QQK5 Q46CK2
WP_011306436.1.36239 WP_011306436.1.74748 269797.Mbar_A1431 gi|73668955|ref|YP_304970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]