SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73669860|ref|YP_305875.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73669860|ref|YP_305875.1|
Domain Number 1 Region: 668-928
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.94e-102
Family BC ATP-binding domain-like 0.000000249
Further Details:      
 
Domain Number 2 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.3e-102
Family BC ATP-binding domain-like 0.000000167
Further Details:      
 
Domain Number 3 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.31e-47
Family BC N-terminal domain-like 0.00000531
Further Details:      
 
Domain Number 4 Region: 544-670
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.6e-47
Family BC N-terminal domain-like 0.00000793
Further Details:      
 
Domain Number 5 Region: 393-540
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 5.89e-47
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000929
Further Details:      
 
Domain Number 6 Region: 932-1068
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 6.41e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73669860|ref|YP_305875.1|
Sequence length 1071
Comment carbamoyl-phosphate synthase large subunit [Methanosarcina barkeri str. Fusaro]
Sequence
MPKREDIKKVLLIGSGPITIGQAAEFDFSGSQACRSLKEEGIKVVLVNSNPATIMTDPEM
ADSVYIEPLDAKIVEKIIEKERPDGIIAGIGGQTGLNITSELAEKGVFEKYGVEILGTPV
EAIKNTEDRELFKETMLRIGEKVPLSRAVNSLKEAEDVVDELGLPLIVRPAYTLGGAGGG
IARTKEELLEITERGLRRSRINQVLIEESVLGWAEIEYEVMRDENDTCIVICNMENIDPM
GVHTGESAVVAPSQTLSDAEHQMLRSASIKIIRALKIEGGCNIQYALKEGDYRVVEVNPR
VSRSSALASKATGYPIARVTAKIAIGMKLDEIINNVTKSTPASFEPALDYVITKIPRWPF
DKFTTADKTLTTAMKSTGEVMAIGRTIEESLLKAFKSLDIDNQLGNKHWDEPETKTLLKT
PTSERLFVIFDALEKGMSVKEIFELSSINPFFISKIKRIVDMEKRIRAEELTPELLREAK
KMGFPDTRLAELTGSTRQEISDLRHKAGILATFKMVDTCAAEFEAATPYYYSTYEDSCET
NATTDKKKILILGAGPIRIGQGIEFDYCTVHAVTALREEGIETHIINNNPETVSTDFDTS
DKLFFEPLTLEYVMNVIEREKPDGVLVQFGGQTSVNLAIPLKQELKRRTDLNTVILGTDP
DDMDLAEDREKFYILMKELGVPQPEGGYATSHKEAIEVAKRIGFPVLVRPSYVLGGRAME
IVYDEIDLERYMKEAVRVSHEHPILIDDFLEAASEIDVDAVCDQKDVIIGAIMEHIEEAG
VHSGDSACVIPPQSLSPEVLDQVRDYTRKIALALKVKGLINIQMAEKCGKVYVLEANPRS
SRTIPFVSKSVGIPLAKIAAKVIAGHSLKSLGYTDEPKPKHVSIKEVLLPFDKLPGADPV
LGPEMKSTGEVMGIDYDFGRAYYKAELAADNVLPLTGKVFLSIRNADKTELVDVAKKLQA
AGLELMGTEGTVNYLARHGVFMDVVKKVHDGSPNVIDMMRRDEVDLIINTPTSKQSRRDG
SRIRRAAVDFKVPYITTMQAAIAAAAAIETMKKGEELTIKSINEYHKEMEN
Download sequence
Identical sequences A0A0E3QL04 Q469Z7
WP_011307341.1.36239 WP_011307341.1.74748 269797.Mbar_A2374 gi|73669860|ref|YP_305875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]