SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73669928|ref|YP_305943.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|73669928|ref|YP_305943.1|
Domain Number - Region: 29-115
Classification Level Classification E-value
Superfamily E set domains 0.0178
Family Filamin repeat (rod domain) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73669928|ref|YP_305943.1|
Sequence length 208
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MKFRIFILGMVLLLLTNIVSAGSQYGTIDVYYNDQLLPGKEVVKPTLKIGEPFKVKIDLT
LNQTSILFVKICSLRVGTPYEVITGPSEFDKKLYFESLDPGTYTYEWILKPTGEWEGGTM
PVNIWYQIHNVGEDKPLVQGEFTVAYPYISNEHYQGETPTFEQSESENQPTSKKPTSENS
SSPASSPAFSLVTAISALVLVFLILSRQ
Download sequence
Identical sequences A0A0E3QN92 Q469S9
269797.Mbar_A2447 WP_011307408.1.36239 WP_011307408.1.74748 gi|73669928|ref|YP_305943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]