SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73669995|ref|YP_306010.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73669995|ref|YP_306010.1|
Domain Number 1 Region: 201-554,583-657
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.27e-124
Family Amylase, catalytic domain 0.000000785
Further Details:      
 
Domain Number 2 Region: 671-774
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.52e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.0055
Further Details:      
 
Domain Number 3 Region: 116-211
Classification Level Classification E-value
Superfamily E set domains 9.8e-18
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 4 Region: 23-64
Classification Level Classification E-value
Superfamily E set domains 0.00000000012
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73669995|ref|YP_306010.1|
Sequence length 774
Comment isoamylase [Methanosarcina barkeri str. Fusaro]
Sequence
MLGELYTDHKQNLKEYHYIIERGYPHPLGATPDENGVNFSIYSEHADYVELLLFDKCDDL
NPALILYTNRVGELTHSENIENSVKVSEDIENIESSVKVSEDIENIESSVKVSENSETTE
ATSIALNKTFHFWHVYVRGLKPGVHYAYRIGGPFDPSRGCRFDGDKVLIDPYSKGNNKTL
WNREKACMPGDNLAFSMRSVVIDMSHYKWGNNSHVTAEKIYEMPGMGEKLYGKKRLQELN
ETIIYELHVGGFTRSPTSGATASGTFSGVIDKIPYLKELGITAVELMPVFDFDDATSLDG
RKQYWGYDPICFFAPHSGYCVNPEYGAHMEEFRDMVRALHKAGIEVVLDVVFNHTAEGDN
LGPVFSFKGIDNSIYYLLEPDEQYYSNYSGCGNTVSCNHPISQKLIVDCLKYWAKEMHVD
GFRFDEGSILSLDTNGKVMKYPPVIWQIELDDALGYIKVIAEAWDAAALNQVGYFPGPRW
AEWNGYYRDEIRRFVRGDPGIVRRVASRIAGSPDLYQSESRLPINSVNFVTCHDGFTLND
LVSYNHKHNEANGENNRDGIENNLSWNCGVEGETEDPEVETLRERQIKNFAAILLLSIGV
PMICMGDEVRRTQKGNNNAYCQDNETSWFDWDLVEKNHDMFRFWKLMIDFRKRHTTILRP
RYFTGKENERGLKDISWHGCKLYSPGWDDPHARALSFTMGEPGDEEDIHVLMNMYWEPLE
FEIPELKGISRSWYRAVDTFLPSPQEIAGAGEETQVNGNSYIVQGRSVVVLISK
Download sequence
Identical sequences A0A0E3LLL1 Q469L2
gi|73669995|ref|YP_306010.1| WP_011307473.1.36239 WP_011307473.1.74748 269797.Mbar_A2517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]