SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73670419|ref|YP_306434.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670419|ref|YP_306434.1|
Domain Number 1 Region: 5-82,191-371,525-734
Classification Level Classification E-value
Superfamily ARM repeat 2.05e-49
Family HEAT repeat 0.073
Further Details:      
 
Weak hits

Sequence:  gi|73670419|ref|YP_306434.1|
Domain Number - Region: 84-198
Classification Level Classification E-value
Superfamily Globin-like 0.00766
Family Globins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73670419|ref|YP_306434.1|
Sequence length 913
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MSERPEIHNKVFSQVSDDRIEAAKQLGTFFEALPDRKQAFEDLLRLCSDGEDAVREEAIN
SLVTVFPNVPDRKLAWDRLLNLTAYPVESVMTAAANALVSVFFLMPDKNKAWGDLAGLIN
SRSSMEDASREIVSSLYYLIKEVSDKAQVWKDLLEMGTSEYSYVREKSTLLLSLVFPELA
DGKKEEAWNKVLELASESADEKIREQATRTLGVIYTQMPDEMKDETLETLLELAVSGKPE
VQKEALLTLPPVFSHIPDKKKAWNDILRLIENENEYIQKQAIDALVFIFPEMPDKKKIWT
DFLSLAKVRDDYIRNMASDALVSLFSGLDNKASLWEELLELSEDEDEVVQSTAVNILTKI
FSHISCKREAYSELVCLAETKDSPALRKVVSTLASAYPELCNIPEVSEREWEEIKKRNYG
EQDRTWKNNFGKLEKPWEEYESGGDSKPKKESKFGKKESGEKEETGENEKTGSLQFKEKE
HRTPVSNLFKKSMSDNSGFEVDNREYIRRKDMTDFIGSGSSFSDKEEAVNKLISLISDPD
PQRRRGAIESLLTAYSRYTGKTQDIWNELLNLTGEEETGTRKDAADLLSEVFPVVEEKST
VFFDLVKLTESQEAHLRRRAAELLSSAFTYCEDKQAAWNELVRLASVEDREVRKGAILAL
SSGYIEVPDKEKAWKDLLSFSDHSDSFVQRAATRALGPAFFYVPDKTQAWRDLKALTDNP
YVYVRRYAFRSLGRASLWRALRAENEATYIFGLKEAVNYFKEASEASIGFHIPEFYHPFY
QSLLFILFSDRPGIAKLENERYLSKMTDEVREKAESQKLLDIFEQFAGLLTRAGKLSPGD
LSGQKKLLETSILLFDQFSGFFDNKEEEAIFAQKTVKKEKPVKKEYSNLGKALLERVEKK
KASLTKDRKKKNF
Download sequence
Identical sequences A0A0E3LLC5 Q467T8
gi|73670419|ref|YP_306434.1| 269797.Mbar_A2959 WP_011307894.1.36239 WP_011307894.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]