SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73670668|ref|YP_306683.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670668|ref|YP_306683.1|
Domain Number 1 Region: 93-244
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 8.37e-25
Family MJ1460-like 0.019
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.49e-17
Family ArsR-like transcriptional regulators 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73670668|ref|YP_306683.1|
Sequence length 245
Comment transcriptional regulator, ArsR family [Methanosarcina barkeri str. Fusaro]
Sequence
MAKPETKTEFFYNDKGLVAIGSPVKLQILNLLREEPRSFDEIVKFTAKAKSTISVHLNNL
RSCELVEENFDPGDRRRKIYYLTSRYMGCSQEPFIENYRSLLDKVPSCGNDRFCFTEILL
HALYFGFEAYGIDNTPVVKMIGNDLGRSISPIFESETPEELLREIGNFLEFQGKCRVTVL
VDIPALQVEDNFKARSIPVIGKPFCTLTEGIIEGILNGKLEKEYRVTETECYGSGHEHCL
FKITI
Download sequence
Identical sequences A0A0E3QIX6 Q466T9
gi|73670668|ref|YP_306683.1| 269797.Mbar_A3221 WP_011308143.1.36239 WP_011308143.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]