SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73670686|ref|YP_306701.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670686|ref|YP_306701.1|
Domain Number 1 Region: 7-59
Classification Level Classification E-value
Superfamily Transposase IS200-like 0.0000000000131
Family Transposase IS200-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73670686|ref|YP_306701.1|
Sequence length 64
Comment transposase [Methanosarcina barkeri str. Fusaro]
Sequence
MVNKKCETRNHSKFLLMYHIIFVCKYRKVILEPISEELKQIMIDISKKSNFEILEMETDT
IFIY
Download sequence
Identical sequences Q466S1
gi|73670686|ref|YP_306701.1| 269797.Mbar_A3240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]