SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73670893|ref|YP_306908.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670893|ref|YP_306908.1|
Domain Number 1 Region: 23-171
Classification Level Classification E-value
Superfamily YutG-like 4.84e-35
Family YutG-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73670893|ref|YP_306908.1|
Sequence length 180
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MKLSDIEERDLKKGQPEKIEEKATVNILDVLAEEGISVQDLADTALEMYVPHPGLETREK
ADALFKRELKYALSDPNLCLLIYSGILLEREGRAGTLPNLSKSSYEKDLTFIIADEVLGT
SIATYISGSKGAFEFVRFDKQKPGILAKLGPFMDDVIGGLIGGVSSNMYSRGMAEFVGKD
Download sequence
Identical sequences A0A0E3LL25 Q465W4
269797.Mbar_A3455 WP_011308367.1.36239 WP_011308367.1.74748 gi|73670893|ref|YP_306908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]