SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Paxru1|834003|fgenesh1_kg.1402_#_5_#_Locus762v1rpkm209.80 from Paxillus rubicundulus Ve08.2h10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Paxru1|834003|fgenesh1_kg.1402_#_5_#_Locus762v1rpkm209.80
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily DOPA-like 9.55e-33
Family DOPA dioxygenase-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Paxru1|834003|fgenesh1_kg.1402_#_5_#_Locus762v1rpkm209.80
Sequence length 181
Sequence
MSPPTDLEEVVNSEVKEWHFHIYFHQHNAEEHHAALQLRDAVLRLRRDGAFVAVPLFRVN
ADPIGPHPVGSYEIWVPATSFASVFSYLCQHRGELSILVHPLTREERRDHEIRRAWLGPS
YPLDLSRLPVLTEDIPLQYPSLKLGYSAPEADFTLEDRRRIGANVERILKNEKEAARAPS
N
Download sequence
Identical sequences A0A0D0DF60
jgi|Paxru1|834003|fgenesh1_kg.1402_#_5_#_Locus762v1rpkm209.80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]