SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Paxru1|26807|fgenesh1_pg.486_#_1 from Paxillus rubicundulus Ve08.2h10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Paxru1|26807|fgenesh1_pg.486_#_1
Domain Number 1 Region: 176-316
Classification Level Classification E-value
Superfamily E set domains 0.00000147
Family Arrestin/Vps26-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Paxru1|26807|fgenesh1_pg.486_#_1
Sequence length 1003
Sequence
MSTVKIALQPPPNVDFVVGYPGIPPGAKDRPQAAVKGAVEVRTGPSGAKAKWVRVELKKI
ETLPGGGQANSYFDHVGPSPISLWQSSEDYSVLQPQDFPFLIRIPESIPPSIALERGAGI
RYELVATVCTLGKKGFFRRRKTTVVSQATTIIIDKHELHSTWPVYSQPESRSVHQEGVHL
AVERNRTCYGPGDRVSVMAILKSDTTNPVIVRGFEFTLKESTIFRAGPSATSAKRSGPQV
KTATIGEQKVPLNVTLYGGSQHKAELGCVIPNTHTTTSLNAARHIDITYVIIVRAWIGSM
QSVMMELPVIVSNWPRNVSEEAVRRIGIAPSLCMSPPSGPAATVPITTTVTRPLTGESQK
HNPSNSLSGVNDFSRPLVPPKQSVQYSTAPVGQNGSAKDKLDADELGTLGAGAKISGTID
HPGYGSSNRPSSRGGLGGIQEDPNSSFGDGGGPSGVESRPSFTSSGRRRRPSANAQNRLT
ITNISEKDAEEGLNPQVPRAARPMTPPSAGRSERQWLSAEDEKKQLYDSAVAKVQKVQGA
VVMGNAAQVGESAAATSTPSKHKKLTPWPTAEEEKVRLYDNAQAIAKRTQAFGASPSIHS
RSSSEANSSGARDKPSSSSSAAPGLAISAGAALYQHAVFSMSKSSNPNNSTNAGDSSRAS
APSPPPSGSTSAPSPRNVPHYPSVEEEKAALSRYYQAKLAVDRSQNTQYASKEGIVGSSS
SSAGPASASLDSTYPQPGGSGRTGSSDVPPPFESSGSSSQPQYLNEKERLRRQYEVQDAA
ALAAQGQAQGQAQTHLHSSPLYTAQTPPYTGPPAVDSGLSEKELLRRRFEEQDAAALAQQ
GQPPQPPPRSNSTRAPPVPPPAVNGFKPLTAAEEKAQLRAKYEAEERGTMNEMTNGHNRA
FSQQSYQHPYAAVASSSDPTSPPPPPLMPRPPVEYIQETQEEDIRRRYYGDQGAGVGLEA
PSAFSNPRLDMRPFTPFDAGFGYEGRNSASSPARPRPPPPAAN
Download sequence
Identical sequences A0A0D0DZ49
jgi|Paxru1|26807|fgenesh1_pg.486_#_1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]