SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Paxru1|702378|CE520358_16931 from Paxillus rubicundulus Ve08.2h10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Paxru1|702378|CE520358_16931
Domain Number 1 Region: 440-505
Classification Level Classification E-value
Superfamily E set domains 0.0000161
Family Arrestin/Vps26-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Paxru1|702378|CE520358_16931
Sequence length 969
Sequence
MLASESNSALSIRLTEPLVFLRSSDPSGRLPPDPNDPPALVRGLLTLNIAKPTRISSIEV
ELTGVATTNWLEGAGPRRIEVTTDHKIYSAASTLFRADHSPYVRRTVSVGPGLSLVNLND
HDDYPHSPRRGRSPDRRDVTASAGPSTFPSAVVNPERAPRRVSCDSSSFTRTGVDVRTGA
GLGPSPPYTPSTWSPFVLQPSSGMPRSHTGSFGGGSTAAENPAQTLEELRQALRDNLEGQ
GYSHGQPSFSLPTPPRTHSCASSISNSSLQRDNDTAHGGTHIHHDDSTLSRHPSAEGEYS
QTRASPLRGRPLNHTSSMRTSRTCSPDGTRTARSPDAGRDTSSTRSGRAYSRFSLSSVLD
AVKEVATAARSRSRGFGVGEETDRGRGRTRVRVVVEEAERDGVDTDERDNNITGDHSRHF
LGRVLGLDWDHDKEKGHEQGEGWKEFKRGTYTYPISFLLPPHLPPTLVRLYGTLGYTLKG
VVHRPGTFTPKLSCHVPLLVVTAPSIGAGEGGGVGDPGPITVERQWEGRLAYIVGLSGRL
FVIGSQRGLDADRPHPRPDSDSQVEPNTEAAHGTVTLDLTLMPLEKVKVWRVSVCIDEQI
SYLAGTGRTARDDGMQRVTLLEVQDDCSAEEISQTEETERYKTKHNDRDVTQIALLPTPL
SPHRSPLLRYLPASADPSTLAGPGPYTLTATLGLPGCDSKSKLHFTVKQKDSNMRIEHTL
RVMMRVEKIGDEGSNEPAKGENMKLFDIAVQTPITILSCRCAPEYQALPRYSRIPDSSQR
QRACPCSSNSSGSRGEGHEHELHQAISNNSTTSSSEGRSMTGSGHDPREHVHINEQNERS
DSYSSLRGRSRSTAPSNPGNLAFPLYPYYGLHARTQPHAHSEGAARSPSHTRSHLSPQDP
SPSRAPQPRSQSLSISHMRPQTPTPHTSPPPSPLVQYERLVSGLESEAGEAPPSYESVAG
FEPALTNGY
Download sequence
Identical sequences A0A0D0E882
jgi|Paxru1|702378|CE520358_16931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]