SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Paxru1|8773|gm1.1020_g from Paxillus rubicundulus Ve08.2h10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Paxru1|8773|gm1.1020_g
Domain Number 1 Region: 2-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-83
Family Capz beta-1 subunit 0.0000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Paxru1|8773|gm1.1020_g
Sequence length 285
Sequence
MADPVDSMLDLMRRLPPSRVEENVNALIRICPDYADDLLGSVDQPLKVMTDRATGRDYLA
CDYNRDGDSYRSPWSNEYDPPLEEGTTPAPKLRKLEIAANEAFDTYREMYYEGGVSSVYL
WELEDGGFAGVVLLKKVMNPSTVDEPSGSWDSIHVFETAERGRQARYKLTSTVMLQLVTQ
HTEKAEDTQAQTNGGHGWKSTGEVNLSGSMTRQTEQDWPMQDSSSHITNTGKMIEEMEIK
MRNLLQEVYFGKTRDIVYDLRSVDDLDKARKQRELQKELVGFIKR
Download sequence
Identical sequences A0A0D0DLQ6
jgi|Paxru1|8773|gm1.1020_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]