SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73668535|ref|YP_304550.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668535|ref|YP_304550.1|
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-52
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73668535|ref|YP_304550.1|
Sequence length 182
Comment pyruvate ferredoxin oxidoreductase, gamma subunit [Methanosarcina barkeri str. Fusaro]
Sequence
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRINNNPIRL
RSQVYTPDYVIVQDATLLETVDVASGVKDDGIIIVNTTENPESLKLNTKARVMTVDATKV
AMDIIGVPIVNTVLLGAFAGATGEINVESIQHAIRARFSGKVGEKNANAIQKAYKLIRGE
EA
Download sequence
Identical sequences A0A0E3QP63 P80523
gi|73668535|ref|YP_304550.1| 269797.Mbar_A1002 WP_011306019.1.36239 WP_011306019.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]