SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FVEG_12760T0 from Fusarium verticillioides 7600

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FVEG_12760T0
Domain Number 1 Region: 8-328
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.91e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.000000196
Further Details:      
 
Domain Number 2 Region: 440-536
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.12e-39
Family D-aminopeptidase, middle and C-terminal domains 0.00011
Further Details:      
 
Domain Number 3 Region: 354-431
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00000654
Family D-aminopeptidase, middle and C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FVEG_12760T0
Sequence length 536
Comment | FVEG_12760 | Fusarium verticillioides conserved hypothetical protein (537 aa)
Sequence
MPVSKEVVQDILKTIPARIRGPGGAVAVLSDGALVDQRVWGYADFNRRIPMTDDTLIPIC
SISKQMLCGLVADLEKNPTPKLAEKGDVKTQFEEKLKEILPELAKTGELKIDHLCNNRSG
IRDYWAITLLWGAKPEDPYSIAEHNEKVLKTIKSTHFTPGTEYSYCNTNFNIVARVVEAT
TGESLSDLLNARIFGPASMKTAQLGADTAKLPPPCVGYEGDEDRGYIPAENRIEWAGDAG
IIASLGDMIAYESFLDRSLFDPTSWYRAIFKPTSFTDGVPSIYSQGLGHSQYGSVAGIGH
GGALRGFRLYRAHVPEERLSVVAMFNHEADAATLVEHIIQTTLALQKPPPPTLVDASPAW
PGIYLDDGTQLAVTIKNGKKGQIVVNYANYAEPVNLTDPERGESRAMVAVVDGDNLRIHR
LKENRTLNAKRLKIGDTQVDNSVFTGDFYSEEIGSTFHCVDQGGLMFGTFEGFLGHSPAQ
FMRYLGGAVWALANPRGMDAKPPGDWTLVFHRDEMGSVTGVTIGCWLARKIEFVKK
Download sequence
Identical sequences W7N307
FVEG_12760T0 XP_018760766.1.41959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]