SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397671024|ref|YP_006512559.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397671024|ref|YP_006512559.1|
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-21
Family DNA-binding N-terminal domain of transcription activators 0.0023
Further Details:      
 
Domain Number 2 Region: 123-271
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.24e-19
Family Multidrug-binding domain of transcription activator BmrR 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397671024|ref|YP_006512559.1|
Sequence length 272
Comment bacterial transcription activator, effector-binding domain protein [Propionibacterium propionicum F0230a]
Sequence
MTETRLIRIGEFSTLTRLSVRMLRYYDANGVLSPAATDDFTGHRFYASSQVRDATLIRQL
RDVGFSVSAIAALLPQRDDPEALGRALAVQRDQLVADAEAVRRRIAEIDRLISHTTRRAT
MADITITTHPAQLVAALRTKIDAYTDEHKVWAKLMEAFEAQDLAYTGEPCGATFHDPEYR
ESDIDIEIWEPVSPGAVASEPLVVRELPEQRVAVAAFRGGYDQFGPVNEELAEYITRSGL
KITGPMYNRYIVGPGKTDDPAQYLTEVCIPVA
Download sequence
Identical sequences I6X4Z1
gi|397671024|ref|YP_006512559.1| WP_014847343.1.90705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]