SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397669662|ref|YP_006511197.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397669662|ref|YP_006511197.1|
Domain Number 1 Region: 1553-1737
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000255
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 2 Region: 1448-1559
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000027
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 3 Region: 1841-1936
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000891
Family Fibronectin type III 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|397669662|ref|YP_006511197.1|
Domain Number - Region: 39-264
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00196
Family Methylamine dehydrogenase, H-chain 0.07
Further Details:      
 
Domain Number - Region: 1271-1351
Classification Level Classification E-value
Superfamily Cadherin-like 0.0393
Family Cadherin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397669662|ref|YP_006511197.1|
Sequence length 2030
Comment fibronectin type III domain-containing protein [Propionibacterium propionicum F0230a]
Sequence
MALVTRKRVETVLVGLVALSLGILALIHRGVPAADVDLNDGGVWVTNQTKRLVGHLNHES
QTIDGALRPPSSSFGVTQSAGNVLVRSSDTVHPVDVASLTFLGEAGVAGVLTAHGGNEVL
FADQSEGRVWATDTRGAASFSLTADPLLKGLDTPRIAVGVEGTGYVLTADGQLYTVTGSG
DQAVTRAQGRKLEGRLSDSAQLTVAGDKIVVLDGTTLTIDGHPVTNDGFAGGVLQQPSGP
SGTVVVATPSELLKVDISSGQVTRESIPNGKPAAPVQLEGCTYALWAESGYYVRDCGGDD
YERAQHPELAAAKQPVFRANRKVIVINDEVTGDVFLPLKQMVKVNNWEQVESQLVDEKQD
KESEETDKSQTREFSEEQHPPQAVDDELGARPGTATVLPVLSNDIDLDGDVLTAIIRDVP
SGVKISQAKEGRALRIEVPADAKDTITFTYQAFDGVDVSNVATVKVNIRAENENSAPHKI
RDSQVNLSERASAGYSVLADWVDPDGDPIYLQQATVEDDSLEMTWRPDGYVSVKDLGKGG
PGRRSVNLTVSDGRDAASGELAAQISPGSTNSPPVANNDHYVATVGHAITLDPRSNDTDS
DSDSLKLVEVSAAPDGVELKPDYQAGTIRFTASKAGNYTLVYGITDGPNNAKGRIRVDVI
DPNSSGLQPVPENDLGLLPANGSLTINALDNDFDPAGGVLAIQGVSQAGAPGLNIEVIKH
SLLRVTAPAGIDSPQSFTYTVSNGHASATAKVLVIPKEPPSTVQSPVAAPDSSVVRVGDL
VTVPVLSNDYSPADLDISLSSDLDVRSDPSLGEFFVSNGAIRFRAGSEAGTAEAIYTVRD
SQGNPASTTVTVNIRAKDEHNEQPTPKQIDSRTFAGSSVRIPVPLDGIDPDGDSVTLGGL
GSQVPKLGAVKVEGNYLVYDASKGASGTDTFTYRVLDRFGAEGEGLIRVGVVPPPAANQA
PVAVADEVAARPSTRLEIPALANDIDPDGDQLQLVKGSAAATDDSWDPKAQTRGQRIVVV
TPAQEGIYHLYYTITDGGGVSDRGVVTVRVASDVPPKAPVANDDVVPTSAIAGVDQVEVP
VLENDSDPDGVVSDLKVTAESPATVKGGTVTVPLADDRQIVLYTVTDSDGLSSRAAIVVP
GREAIPPAINTGRGQARVKAGEPLTIRFTDWVVTRPGRTARLTSVDSVVAGPGGSPEVGN
NGVRVIDDQTIEFTPAKNFSGQTTVSFEVTDGGSMDDSTALKSKLSLSVIVEGDGQQPPQ
LRPTQLRVAPDEAPQKISLSNMVSDPNPGDNDTMSYSLVSTDGPVQASVSGQELSVSVPK
GTPVGSTGSIVVQVHDGSTDPVNMTIPVTVIASTRPPMTISEIVERDGRVGNTASFDLTR
WVTNPFADTGGEITLVGSPQVRGSATVTSEGNVINVTPTDSGTGADTVDDVLVTFRVADA
TKDPSRERTGVIRVVVKDVPRAPTAVTAQYAGSQTARVSWTHSGWRGATPKGFTVFWQGG
SKNCGLQTTCDIPGLANSGRYTFTVKAEVAEGDLNSRSPRSEPSNEILVDALPSKPSAPT
AAFGDQQIALTWEAATVPGGGSPVTRYTVTMYPGGQKQETTATSLTWTGLTNGQAYTFTV
TAHNRLTDENSQLTPPTSDESRPETPAGAPSNQGAPTVSMDSSSSSVKPRANIKWSPPGN
PNGDSNFRYVVTDANGKEVCPEQQDTSCTTPMDPSTETVTFSVRSTNKSGKWSAASPASN
AVRAFQPPGAPSGFSLRPTGKGSEVEFSFGAASGNGVRADEITYRWSAGSQSGTVKPGRT
VVSSPAFQLGQAVTVRLVAVANVLGQTSEGEAATATVTAYGPPQAPVVNSEPGVDHVTLR
WQVPGSSNGARVKQVEITSTVKAEGRNPSVETWTTTDLSGSVDKGNDRKQNVCVKARTQN
EHGDWSDYSAESCASTWGDTKATLSKGDSVECPDGGGRGCNAFKVTLQNWQPGGRVKCEV
PNPADQEDVAKVKVGPVDASGNASRQFSDWVFPENYNVPSEGFDITARCR
Download sequence
Identical sequences I6Y2Z2
gi|397669662|ref|YP_006511197.1| WP_014845982.1.90705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]