SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397669966|ref|YP_006511501.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397669966|ref|YP_006511501.1|
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily SIS domain 3.84e-19
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397669966|ref|YP_006511501.1|
Sequence length 230
Comment hypothetical protein HMPREF9154_1235 [Propionibacterium propionicum F0230a]
Sequence
MSSLGNWIDEVVAHNRKQISVAATCIARTHRAGGLVFTAGSGHSLAMVMETFFRAGGLAI
VRPLFRADMLPLNGALRSTMAERETGVGTEVVAAVDPGPRDLVAIFSNSGRNPYPVEIAE
GARARGAVVVALTSVGASQANPPRGAHRLYEVADVVLDTMVPPGDVSSPAGNPVTSPLST
LACCALWTEILADTVELDPGVRLWRSANQDGNDGFNTALAGQLRDRIPEL
Download sequence
Identical sequences I6X2V1
gi|397669966|ref|YP_006511501.1| WP_014846286.1.90705 WP_014846286.1.99876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]