SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PKH_124590 from Plasmodium knowlesi strain H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PKH_124590
Domain Number 1 Region: 80-299
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-46
Family Kelch motif 0.0012
Further Details:      
 
Domain Number 2 Region: 432-480,521-585
Classification Level Classification E-value
Superfamily POZ domain 1.33e-16
Family Tetramerization domain of potassium channels 0.071
Further Details:      
 
Domain Number 3 Region: 339-435
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-16
Family Kelch motif 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PKH_124590
Sequence length 644
Comment PKH_124590 hypothetical protein, conserved in Plasmodium species 16952255:16954189 reverse MW:74398
Sequence
MNLPPGKANPKSKEVAPSAYPRVNKECPSMRSGKNESRKVLTWNKLNGPPNSAKTNYKKI
DEKNSAHTNGEASQNSMGYWNEEKNVCLPRRTGAASVLYKNQIYIFGGYKSERRLNDFYK
YNIAENEWIKIESLNGPSRRENNPAFLFKDKMYILGGYQGNEIWLNDFYAYDFGREKWQV
VNVKKESMRFAPPSLFGFALSVDEVKGILYLFGGYDGKSVHNKMYAFDLEEEKWIQTKQS
GEIPSPRSCAIGHISDGYFYIFGGYNGEYGLDIFYQYHLETGIWTEMKYNMIEGSEFGST
SVEEGYESDEVQLLGDSRVGRIPQQKRKCQTQVSPNNTAIPVARYFMGSFIHNKCIYILG
GYNGLRCERLNDLYKFDLHKRIWFKIHTCNNFSSRSSMNTHFYKNVIYCIAGFDGKNSLS
DVYALKLEDVHIEPSCLMEYYRMMVNNYRYADVIFLVQNKYIYGCSSILLSRCPAFKTLL
NLFTSSGASSSSEMSPAEMEHYRVAKNLPGMNDGTEKGEKIKNLRVIPIHDIDHDIFLII
VNYLYTDELSMSYSLDTYVLIVLASYRYSIFRLMQLCERAISHHINESNVMDILILSYRI
CCKQLCTACIDFIINNKLLDEAKINRLTLEPYLLGEIYKKWIFN
Download sequence
Identical sequences A0A1A7VKU3 A0A1Y3DMW1 B3L9G3
XP_002260269.1.91479 PKH_124590 gi|193810342|emb|CAQ41536.1| gi|221059247|ref|XP_002260269.1| 5850.PKH_124590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]