SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PKH_145360 from Plasmodium knowlesi strain H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PKH_145360
Domain Number 1 Region: 47-80,114-181
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000188
Family BTB/POZ domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PKH_145360
Sequence length 524
Comment PKH_145360 hypothetical protein, conserved in Plasmodium species 22721837:22724329 reverse MW:59100
Sequence
MQVYIQTVVLWKYTQYACGRRSFKHTPVASTAFSSFPFFDFSSPSADNVISINVGGTIYM
TTLNLICKYRNSRLCEIVLGNLVFLLSESVSAPTRGNICLGFIEWFLSTSVDASFPIRRF
PFRYVLCAGNRFEYILDFLRDGVLICENDINVLTRILIEAVYFKLFSLIKILKKKIQLLY
SNMGSNVNKNIFKNIIGTLEEKKQNKIKSKEKNNSISRMLNKISAHIKKHKEVKCCIVKK
KKNHNVHSLNKVNLLNELNDGDESFTKGEVNMANYKLLSSAPRDSGKEEKEIVFVKDLGD
KEKNGANIDFNNEGKVNTQHNLPEIILPNPSTLSKYTKNLDYNITNNFKNEEDKLKNKNN
ANGSNQINCLVKNIERKGYSPVSLSPNGNLKSGDNKTLSFAKSTSIFIYGKEGYPTCVFT
ALSHNGIKDPVGTSTQSSNRSLSPTSIGGANYLGYSSFDNYTSTSDHLDRACYKYNNYTY
NNMNNPRGQILVHSEIDDIEETSPFPILSNVNLGEQIFSTTVDF
Download sequence
Identical sequences B3LCZ8
XP_002262429.1.91479 PKH_145360 gi|193811579|emb|CAQ42307.1| gi|221061719|ref|XP_002262429.1| 5850.PKH_145360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]